KEGG   Desulfovibrio alaskensis: Dde_2317Help
Entry
Dde_2317          CDS       T00294                                 

Definition
(GenBank) Butyrate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00010  Glycolysis / Gluconeogenesis
dde00620  Pyruvate metabolism
dde00640  Propanoate metabolism
dde00680  Methane metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01120  Microbial metabolism in diverse environments
dde01130  Biosynthesis of antibiotics
dde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dde_2317
   00620 Pyruvate metabolism
    Dde_2317
   00640 Propanoate metabolism
    Dde_2317
  Energy metabolism
   00680 Methane metabolism
    Dde_2317
Enzymes [BR:dde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dde_2317
Lipid biosynthesis proteins [BR:dde01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dde_2317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABB39114
UniProt: Q30YY2
Position
complement(2334636..2336285)
Genome map
AA seq 549 aa AA seqDB search
MKKIVSASYEDFCRDFTLNVPANFNFAFDVLDRLASERGDDVAVVHVDDAGVRRDYTFGW
LHGQSCRMANALKQRGLRKGDRVMLILYRSIEFWVSMLALHRLGAVPVPSPAQLMPKDIV
FRVNRANIRGMIVESSLTGRIEEARPQTETLDVLVQSGKGCLPAGWSDFHDMVQQASADF
PRPAAPAENAGGDDPLLIFFSSGTTGMPKMVEHNHLYPLGHYMTGAYWHDLEPGDLHLTL
ADTGWGKALWGKFYGQWMAGAAVFVYDFRGKFVPAELLRIMAENRITTFCAPPTVYRFLV
REDLSQYDLSCLRHCTTAGELLNESVYADWLAATGLPIYEGYGQTETTLQVATFRNMQPK
PGSIGRPVPGWDVVLMDAGGNMCPAGEEGEICVRVAEGAPVGLFKGYLDEPEKTASVMFD
GYYHTGDKAWMDEDGYLWFLGRVDDLIKSSGYRIGPFEVESALVSHPAVIEAAVTGVPDP
LRGQAVKATVVLAGGYEAGEALTKELQNHVKKVTAPYKYPRIIDYVDELPKTISGKIKRA
EIRQRDEQA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatagtcagtgccagctacgaagatttttgcagagattttaccctgaatgtg
cccgcaaatttcaactttgcgtttgatgtgctggacagactggcctctgaacggggtgat
gatgttgccgtggtgcatgtggatgatgccggcgtccggcgcgactacaccttcgggtgg
ttgcacggtcagtcctgccgcatggccaatgcgctgaaacagcgcggtctgcgcaagggc
gaccgtgtgatgcttatcctgtaccgcagcatcgagttctgggtaagcatgctggcgtta
catcgtctgggcgccgtgcccgtgccttcgcccgcgcagctgatgcccaaggatattgtt
tttcgtgtcaaccgcgccaacatccgcggtatgatagttgaatcatcgctgacaggccgt
atagaagaagcccgtcctcagacggaaacgcttgatgtgctggtgcagtccggcaaaggc
tgtctgcccgcgggctggagcgacttccatgatatggtgcagcaggcatcggctgatttt
ccccgacctgccgctccggctgaaaatgccggaggcgatgatccgctgctgattttcttt
tcatccggcaccaccggaatgcccaagatggtggaacacaaccatctgtacccgctggga
cattatatgaccggtgcctactggcacgacctggaacccggagacctgcacctgactctt
gccgacacaggctggggcaaggcgctgtggggcaagttctacggccagtggatggccggt
gccgctgttttcgtttatgattttcgcggcaagtttgtgccggcagagcttttgcgcatc
atggccgaaaacaggataaccaccttctgcgcaccgcccacggtgtatcgttttctggtg
cgcgaagacctttcgcagtacgacctttcctgcctgcgccactgcaccacagccggtgaa
ttgctgaacgaaagcgtttacgccgactggctggcagccaccggactgcccatttatgaa
ggctacggacagacggaaaccactctgcaggtggccacgttccgcaacatgcagcccaag
cccggctccatcggcagaccggtgcccggctgggatgtggtgctgatggatgccggcggt
aatatgtgtcccgccggtgaagagggcgaaatatgtgtccgcgtggccgaaggcgctcct
gtggggcttttcaaggggtatctggacgagccggaaaaaacggcgtcggtgatgtttgac
ggctactaccataccggcgacaaggcatggatggacgaggacggatatctgtggtttctg
ggccgcgtggatgacctcataaagagctccggctaccgtatcggcccgttcgaagttgag
tcggcgcttgtttcccatcctgcagttattgaagctgcggttaccggcgtgcccgaccct
ctgcgcgggcaggcggttaaagccacagtggtgctggccggcggttatgaagccggtgaa
gccctgactaaagagttgcagaaccatgttaaaaaggtgactgcaccgtataagtatccg
cgtatcatagattatgtggacgaattgcccaaaaccataagcggcaagatcaagcgggct
gaaatacgccagcgtgacgaacaggcctga

DBGET integrated database retrieval system