KEGG   Desulfovibrio alaskensis: Dde_2823Help
Entry
Dde_2823          CDS       T00294                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00010  Glycolysis / Gluconeogenesis
dde00620  Pyruvate metabolism
dde00640  Propanoate metabolism
dde00680  Methane metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01120  Microbial metabolism in diverse environments
dde01130  Biosynthesis of antibiotics
dde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dde_2823
   00620 Pyruvate metabolism
    Dde_2823
   00640 Propanoate metabolism
    Dde_2823
  Energy metabolism
   00680 Methane metabolism
    Dde_2823
Enzymes [BR:dde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dde_2823
Lipid biosynthesis proteins [BR:dde01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dde_2823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABB39618
UniProt: Q30XH8
Position
2807194..2809173
Genome map
AA seq 659 aa AA seqDB search
MSAKQPLCTAPEGSGTLDTLLCEERVFRPMPRIVAEANMNPQDVAIARARAESDWLGFWE
EAAEELSWFRKWDAVLDDSAAPFYRWFAGARCNIVYNALDRHIETANKNKLALIWEGEPG
DTRKLTYYELYREVNKAANALRAAGIGKGDRVLIHMPPLPETVIAMLAAAKIGAVHSVVF
GGFSARSLRDRINDATPAAIITADGFYRNGRVITLKGTVDAAVAKCSGAAAAVLKKVVVV
HRVLVETAMKEDRDVWYHDFVRDQPDEAFTESLDAAHPLFILYTSGTTGAPKGIVHAHGG
YMVGVNRTLDWVFDLKPTDIFWCTADPAWITGHSYVVYGPLMAGTTTLLYEGHPLYPEAG
RAWSVVQRWGVTVLYTVPTLIRMLMRFGRQNPDRHTLGTLRLLGTVGEPISPEAWTWFHK
HIGRSRCPVLDTWWQTETGMFMISPLPVSLLKPGSVTRPLPGVEVDVVDESGAPVPHGQG
GYLVIKKPWPAMLTTIFNDPEAYRRLYWERFPGWYFSGDVARKDEDGYLWIQGRADDVML
IAGHRIGTAELEAALASHPAVAECAIVGVPDEIRGEVAKAFVVLHDDQPPVATMMMTGET
DQDLIEHARRELGPVAVIREVEFRSALPKNKNGKIMRRLLRAESTGQSTGDLSTLSTDI
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaaacaaccgctatgcaccgcccctgaaggttcaggaactctggacaccctg
ctgtgcgaagaacgtgtgttccggcccatgccgcgcatcgtggcagaggcgaacatgaac
ccgcaggatgtggccatcgcccgtgcccgcgcggaaagcgactggctgggattctgggag
gaagcggcggaagaactttcgtggttccgcaaatgggatgccgtgctggatgattccgca
gctcccttctaccgctggtttgccggtgcccgctgcaacattgtctacaatgcgctggac
aggcacatagaaaccgcaaacaaaaataaactggcgctcatatgggaaggcgaacccgga
gacacacgcaagcttacctattacgaactgtaccgcgaagtgaataaagccgccaatgcg
ttgcgggccgcgggcataggtaaaggcgaccgggtgctcatccacatgccgcctttgccg
gaaaccgtcatagccatgctggctgcggcaaaaatcggcgcggtacattccgttgttttc
gggggattttccgcacgcagcctgcgcgaccgcattaatgacgccacacctgctgccata
atcaccgcagacgggttctaccgcaacggcagggtgataacgctgaaaggcaccgtggat
gccgcggtggccaaatgttccggcgcggcggctgccgtgctgaaaaaagttgtggtggtg
caccgcgtgctggtggaaaccgccatgaaagaagacagagacgtctggtaccacgatttt
gtgcgcgaccagcccgatgaagcattcaccgaatcactggatgccgctcacccgctgttc
atcctgtacacatcgggcaccacaggcgctcccaaaggcattgtacatgctcacggcggg
tacatggtaggcgtcaaccgcactctggactgggtgttcgaccttaaacccactgacatt
ttctggtgcacggccgatcccgcgtggatcaccggacacagctacgtggtatacgggccg
ctcatggcgggcaccacaacgctgctttacgagggacatccgctgtaccccgaagccggc
cgggcctggtccgtcgtacagcgctggggtgtcacggtgctgtacacggtgcccacgctc
atacgcatgctgatgcgcttcgggcggcagaaccccgaccgccacacgctgggcaccctg
cggctgctgggcaccgtgggcgaacccataagccccgaagcgtggacgtggtttcacaag
catatcggccgcagccgctgccctgtgctcgacacatggtggcagacagaaacgggtatg
ttcatgatttccccgctgccggtatcgctgctcaagcccggttccgtcacacgcccgctg
ccgggggtggaagtggacgtggtggatgaaagcggtgctccggtaccgcacggacaaggc
ggatatctggtcatcaaaaaaccgtggcccgccatgctgaccaccatcttcaacgatccg
gaagcctatcgcaggctgtactgggagcgctttcccggctggtatttttccggcgacgtg
gcccgcaaagacgaagacggctacctgtggatacagggccgtgccgatgatgtgatgctt
atagcggggcaccgcataggtaccgccgaactggaagccgcactggcttcgcaccctgcc
gtggcagaatgcgccatagtgggcgtgcctgacgaaatacgcggagaagtggccaaagca
tttgtggtgctgcatgacgaccaaccccccgtggccaccatgatgatgaccggagaaacc
gatcaggacctcatagaacacgcccggcgcgaactcggccccgtggccgtcatccgcgag
gttgaattccgcagcgccctgccgaaaaataaaaacggcaagatcatgcgacgcctgctg
cgcgccgaaagtaccggacagtccaccggcgacctttccaccctgagcacggacatctga

DBGET integrated database retrieval system