KEGG   Desulfovibrio alaskensis: Dde_3062Help
Entry
Dde_3062          CDS       T00294                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00010  Glycolysis / Gluconeogenesis
dde00071  Fatty acid degradation
dde00350  Tyrosine metabolism
dde00625  Chloroalkane and chloroalkene degradation
dde00626  Naphthalene degradation
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01120  Microbial metabolism in diverse environments
dde01130  Biosynthesis of antibiotics
dde01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dde_3062
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dde_3062
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Dde_3062
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dde_3062
   00626 Naphthalene degradation
    Dde_3062
Enzymes [BR:dde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dde_3062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABB39856
UniProt: Q30WU0
Position
3054413..3055591
Genome map
AA seq 392 aa AA seqDB search
MMHFNFHMPTRLIFGQGTLRRLAGEPLPGTRALVVVSAGGSMKKLGYLEQVRSLLAQNGC
ESEVYDRIQPNPVKEHVMEGAALARSARCDFIVGLGGGSSIDSAKSIALMAANPGDYWDY
MGGTGGGKTPPEPALPVIAIPTTAGTGTEADPWTVITNTATREKIGWGNDSTFPRFSIID
PMLMLSVPPSVTAYTGMDAFFHATEAYLATCNQPSSDLLAQQAIHLISTFLPQCVHDGSN
PETRTMLAWASTAAGICESLSSCISHHSLEHALSAFYPDIPHGAGLVMLSEAYFSHLARF
VPERMTHLGYFMGVDVDSLPEERQPEAFVHALAKLKADCGLAELKMSDFGVKRSDLPALA
RNARESMGGLFHVTPVELDEAAVLDIFEKAYR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgatgcattttaattttcacatgcccacacggcttattttcggacaaggcaccctgcgc
cggctggccggagaacccctgccgggcaccagagcactggttgtggtcagcgccggtggt
tccatgaaaaagctcgggtatctggaacaggtacgctcgctgctggcgcaaaacggctgc
gaaagcgaagtgtatgatcgcatacagccaaaccctgtcaaagagcatgtgatggaagga
gccgcgctggcacgctcggcccgctgcgatttcatcgtcgggctgggaggcggcagcagc
atcgattccgcaaaatccatcgccctcatggccgcaaaccccggagactactgggactac
atgggcggcaccggcggcggcaaaacaccgccggaaccggcgctgcctgtcattgccatt
cccaccaccgcgggtaccggcacagaggccgacccgtggacagtcatcaccaacaccgcc
acgcgtgaaaaaataggctggggcaacgactccacgtttccccgtttttccatcatcgac
cccatgctgatgctcagcgtaccgcccagtgtcaccgcctataccggcatggacgccttt
ttccacgccacagaagcatatctggccacctgcaaccagccctccagcgacctgctggcc
cagcaggccatccatcttatctcgacatttctgccgcagtgcgtgcacgacggaagcaac
cccgaaacacgcaccatgcttgcgtgggcatccacagccgccggcatctgcgaatcactg
tcgtcgtgcatatcgcaccattcgcttgagcatgcgctttcggcattttatcccgacatt
ccgcatggtgccggactggtcatgctgtccgaagcgtacttcagccatctggccagattt
gttcccgaaagaatgacgcatctgggctatttcatgggtgtagatgtggacagcctgccc
gaagaacgtcagcctgaggcatttgttcacgcgctggcaaagctgaaagccgactgcggg
ctggcagaactgaaaatgtctgatttcggtgtgaagcgctccgacctgcccgcgcttgcc
cgtaatgcacgcgaaagcatgggcggactttttcatgtgacgccggtggaactggacgaa
gccgctgtccttgatattttcgaaaaagcctacagataa

DBGET integrated database retrieval system