KEGG   Desulfovibrio alaskensis: Dde_3064Help
Entry
Dde_3064          CDS       T00294                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
dde  Desulfovibrio alaskensis
Brite
KEGG Orthology (KO) [BR:dde00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Dde_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Rrf2 YhdK
Motif
Other DBs
NCBI-ProteinID: ABB39858
UniProt: Q30WT8
Position
complement(3056564..3057973)
Genome map
AA seq 469 aa AA seqDB search
MKRDMGTEQLQERAGRLVRFVTRDIWLQDMEKARGRRRGILGVLRWLYLVVHGFVADQCL
LRASALTYTTVLSIVPTLAVAFSISKGLGIQNTEFIRVLLMRIAAGREDTVTQILAYVDN
TNVKTLGAVGLLALFVTVGSLMGTIEKAFNSIWGVARGRTLWRKFTDFFSVTLVCPIVMA
AAFSFSVSLRHETLVQKLLNVGIVSYAYVAFLKMVPFLMIALMLFFIYVFIPNTRVRFGS
ALLGGLVAGLLWTLAEGAYVGYQIGAARYNAIYGGFAQLPLFLIWVYVTWVIVLLGAEVS
FAVQNVRTFESEIRADTASREERDKLAVLVMLALTRAFYATAGPVPLDRLCMVARAPVRL
VQDTLAAMERVSLVVGTEGDDPRYALTAPPESIRVMDILLALASHKVTGDRPPVTEDFPF
VDAVFRRFYEASAASTGNLSLKEFHDGHLPDSFAAELVLPERGSVVQGG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgatatgggaaccgaacagttgcaggagcgtgccggaaggctggtgcgtttt
gtcacgcgggatatctggttgcaggatatggaaaaagcccggggcaggcgcagggggatt
ctgggtgtgctgcgctggctgtatctggtggtgcacggttttgtggccgaccagtgcctg
ctgcgcgcttctgcgcttacctacaccacggtgctttccatcgtgcccacgctggcggtg
gcgttttccatttccaaggggctgggcatccagaataccgagttcatcagagtgctgctg
atgcgcatagccgcaggcagagaagacaccgtgacccagattctggcctatgtggacaat
accaacgtgaaaacgctgggggccgtggggctgcttgcgctgttcgtcacggtggggtcg
ctcatgggcaccattgaaaaggcgttcaactccatctggggtgtggccagaggccgtact
ctgtggcgcaagttcacggactttttttctgtgactctggtctgtcccattgtcatggcg
gcggctttttcgttttctgtttcgttgcggcacgaaacgctggtgcagaagctgctcaat
gtaggcattgtcagctacgcttatgtggcgtttctcaagatggtgccttttctgatgatc
gccctgatgctgttttttatctatgtgttcattcccaacacgcgggtgcgcttcggcagt
gcgctgctgggcgggctggtggcggggctgctgtggactctggcagaaggagcctatgtg
ggctaccagataggcgcggccagatacaatgccatctacggcggttttgcgcagctgccg
ctttttctcatctgggtgtacgtgacatgggtgattgtgctgctgggggcggaggtcagc
tttgccgtgcagaatgtacgtacctttgaaagtgaaatacgggccgatacggccagccgt
gaagaacgggataaacttgcggtgctggtcatgctggcgctgacaagggctttttacgcc
acggccggtcctgtgccgctggacaggctgtgcatggtcgcgcgtgctcctgtgcgtctg
gtgcaggatacgctggctgccatggagcgcgtttctctggtggtgggaaccgaaggcgac
gacccgcgttatgcgctgacagccccgcccgaatcaatccgtgtcatggacatactgctg
gcgctggccagtcacaaagttacgggcgacaggccgccggtgacagaagattttcctttt
gtggatgccgtgttccgcaggttttacgaggcttcggcagccagcacgggtaatctttca
ctgaaagagtttcacgacgggcatctgccggacagctttgccgcggaacttgtgcttcct
gaacgcggttctgttgtgcaggggggctga

DBGET integrated database retrieval system