KEGG   Desulfovibrio alaskensis: Dde_3071Help
Entry
Dde_3071          CDS       T00294                                 

Definition
(GenBank) polar amino acid ABC transporter, inner membrane subunit
  KO
K02029  polar amino acid transport system permease protein
Organism
dde  Desulfovibrio alaskensis
Module
dde_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:dde00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dde02000]
    Dde_3071
Transporters [BR:dde02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Dde_3071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Lig_chan
Motif
Other DBs
NCBI-ProteinID: ABB39865
UniProt: Q30WT1
Position
complement(3062244..3063173)
Genome map
AA seq 309 aa AA seqDB search
MNPMPAAVPEERAVECDGSMPRDAAAKGRCRVRLPVRIWRAVTDARRPWAVDMMLYLAVM
TGVVWFTLRGTEQLGYHWQWHRALRYLADTRGGWHAGPLLQGLLVTFKVSAVSLVLAAVI
GLAAVLLRLSRSVVGRALAVCYLETVRNTPLLIQLFVMYFVVAPLTGMDRFFSAVLALSL
FEGAYISEIIRAGIQAVPAGQWEAARSLGLTRAATYRKVVLPQALGHVLPPLTGQMVTLV
KDSALVSTIAIYDLTMQAQAIIAETFLVFEIWFMVAAMYLVVTLSLSLLAQRLECRLRTG
SKACRKAAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgatgccggccgccgtgccggaggagcgcgccgtggaatgtgacggcagcatg
ccgcgcgatgccgctgcgaagggcagatgcagggtgcggctgccggtacgcatctggcgc
gcggtgacggatgcacggcgtccgtgggcggtggatatgatgctgtatcttgccgtcatg
accggggtggtgtggtttacgctgcgcggtacggaacagctgggctaccactggcagtgg
caccgtgccctgcgctatcttgcggacacgcgcggcggatggcatgccggtccgctgctg
caggggctgctggtcaccttcaaggtatcggccgtcagcctggttctggcagccgtcata
gggcttgccgcggtgctgctgcggctttcgcgttctgtggtggggcgggctcttgctgtc
tgttatcttgagactgtccgcaatacgccgctgctcattcagctttttgtcatgtacttt
gtggtggccccgctgacgggcatggacaggtttttttccgccgtgctcgcgctcagcctg
tttgaaggcgcctatatatcggaaataatccgtgcgggcatacaggctgtacctgccggt
cagtgggaggctgcacgcagtctggggctgacccgcgcggccacttaccgcaaggttgtg
ctgccgcaggcgctggggcatgtgctgccgccgcttaccgggcagatggtcacactggtt
aaagattcggcgctggtaagcaccattgccatttacgacctgaccatgcaggcgcaggcc
attattgcagaaacatttctggtttttgaaatctggtttatggtggctgccatgtatctt
gtcgttacgctcagtctttcactgctggcacagcgccttgagtgccggctgagaaccgga
tcaaaggcatgtcgcaaggctgccgcataa

DBGET integrated database retrieval system