KEGG   Desulfovibrio alaskensis: Dde_3074Help
Entry
Dde_3074          CDS       T00294                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor
  KO
K03406  methyl-accepting chemotaxis protein
Organism
dde  Desulfovibrio alaskensis
Pathway
dde02020  Two-component system
dde02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dde00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dde_3074
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dde_3074
Bacterial motility proteins [BR:dde02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Dde_3074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal PAS_9 PAS_4 PAS HAMP AAA_24 BLOC1_2
Motif
Other DBs
NCBI-ProteinID: ABB39868
UniProt: Q30WS8
Position
complement(3063780..3065369)
Genome map
AA seq 529 aa AA seqDB search
MFSKISVKALALLTAAAGLAVPLCVAGWQYASAPSGDVRSLLLWGAVSTVAAYCLVVVPL
AVVLVRKVTRPVAEIQQRVEKILDGDYSVCFACDGGDELAEMRLALDSLLSRLKYNLGFA
QGVLKGIDTPFVVVDNDEVLTYTNPSLISLLEQTGKPEDHYGQNVALFFYGDASRRTVLR
DSLEHHTVTSREVDLTTRKGNTRRIQIHASPLFDLSGGLMGALCIYQDLTDLRAREAEIV
SKNESIAAAVKSSETVSLTVSEIAGSVDQLIMQSARDAETQTERTVESASAMEQMNVAVL
DVARSASAAAEQAGIACDKARQGAGVVEEAMNAIDEVARLAEGLKVSMGDLGRQAEGIGQ
VMTVISDIADQTNLLALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMQATSEVGAAITS
IQAGTRNNVQNVEASVLAVQRSRELSSASGDSLREIVDLVIRTTDQVQAIATASEEQSST
SEHISQAVDEVRIISENSARSLAEAAGMVHKLSAKAGELQRIISTVASS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttttctaagatttcggttaaggcgctggctctgctgaccgcagctgccggactggct
gtgccgctgtgtgttgcggggtggcagtatgcctctgccccgtccggcgatgtgcgcagc
ctgctgctgtggggggcggtgagcactgttgcggcgtactgtcttgtcgtggtgccgctg
gctgtggtgctggtgcgcaaggttacgcgtcccgtggcggaaatacagcagcgtgtggaa
aaaattctggacggcgattacagcgtctgctttgcctgtgacggaggcgacgagctggct
gaaatgcgtcttgcacttgattcgctgctttcacggctcaagtacaatctgggatttgca
cagggcgttctcaaaggtatcgatactccctttgtggtggtggataatgatgaggtgctg
acctacacaaacccgtcgctcatcagtctgctggagcagaccggaaagccggaagaccac
tacgggcagaacgtggcgttgtttttttacggcgatgcatcgcgcagaacagtgctccgc
gacagtctggagcatcataccgtgaccagccgcgaggtggatctgaccacgcgcaagggc
aacacgcggcgcattcagattcatgcctcgccgctgtttgacctgtcgggcgggcttatg
ggcgcattgtgcatctatcaggatctgacagacctgcgtgcgcgcgaggcggagatagtc
tccaagaatgagagtatcgccgccgcagtgaaatcgtctgaaacggtttcgcttaccgtg
agtgaaattgccggaagcgtggaccagctgataatgcagtctgccagagatgcagagaca
cagacggaacggacggtggaaagcgcgtctgccatggagcagatgaacgtcgcggtgctg
gatgtggcgcgcagtgcctcagcggctgcggaacaggcgggcatagcctgcgacaaggcc
cgtcagggggccggggtggtggaagaagccatgaacgccattgacgaggtggcgcggctg
gcggaaggcctgaaggtgagcatgggcgatctggggcgtcaggccgaaggtataggacag
gtgatgacggtcatcagcgacattgccgaccagaccaacctgctggcgcttaacgcagcc
atcgaggccgcccgtgccggtgacgccggacggggctttgccgtggtggccgatgaagtg
cgcaagctggcggaaaaaaccatgcaggcaacttcagaggtgggcgcggccattacctcg
atacaggcgggcacccgcaataatgtgcagaacgttgaagcatcggtgctggcggtgcag
cgttcccgcgagctttcatcggcttccggtgattcgctgcgcgaaattgtggatctggtc
atccgcaccaccgatcaggtgcaggccatcgccacggcaagcgaagaacagtcttccacc
agcgaacatataagtcaggcggtggacgaggtgcgcatcatttctgaaaattcggcgcgt
tcgctggctgaagccgcgggcatggtgcacaagctttccgcaaaggccggtgaactgcag
cgcatcatttccacggtggcgtcttcgtaa

DBGET integrated database retrieval system