KEGG   Desulfovibrio alaskensis: Dde_3080Help
Entry
Dde_3080          CDS       T00294                                 

Definition
(GenBank) cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00270  Cysteine and methionine metabolism
dde00920  Sulfur metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01120  Microbial metabolism in diverse environments
dde01130  Biosynthesis of antibiotics
dde01200  Carbon metabolism
dde01230  Biosynthesis of amino acids
Module
dde_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Dde_3080
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dde_3080
Enzymes [BR:dde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Dde_3080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABB39874
UniProt: Q30WS2
Position
3070183..3071112
Genome map
AA seq 309 aa AA seqDB search
MNIAENMAALVGNTPLVRLNRLARGCHAEVVAKLEFYNPCASVKDRIARSMIESALESGE
INADSLLVEPTSGNTGVGLAFICAVHGLRLTLTMPESMSDERKKLLRSFGTTLVLTPAAQ
GMRGAIAEAERIVRETPGAVMLQQFANPANPAAHYATTAEEIWRDTDGRVDAFVAGVGTG
GTITGTGRRLRELNAGVRIIAVEPEASPVLSGGAPAPHPIQGIGAGFVPEVLDTGIYDEV
FKVSGDDAMNTARDLLRQEGILCGISSGANAFAALEAARRPEMKGKRIVFIVCDTGERYL
STPLFSGQS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcgcagaaaacatggccgctctggtcggaaacaccccgctggtacgcctgaac
aggctggcacggggttgtcacgccgaagttgtcgccaaactggaattttacaacccctgc
gcctcggtaaaagacagaatcgcccgcagcatgatcgaatcggcactggagtcgggagaa
atcaacgccgattcgctgctggtggaacccaccagcggcaataccggtgtggggctggcg
ttcatctgcgcggttcacgggctgcggctgaccctgaccatgccggaatccatgagcgac
gaacgtaaaaaactgctgcgcagtttcggcaccacgctggtgctcacccccgcggcacag
ggtatgcgcggcgccattgcagaagccgagcgcatcgtgcgtgaaaccccgggagccgtc
atgctgcagcagtttgccaatcccgccaaccccgcggcacattacgccacaacggctgaa
gaaatatggcgcgacacagacggcagggtggatgcgtttgtggccggtgtaggcaccggc
ggcaccatcaccggtaccggcagacgcctgcgcgagcttaatgcgggggtgcgcatcatc
gccgtggaacctgaagcatcccccgtgctttcgggcggtgctcccgcaccccaccccatt
cagggcataggcgcaggctttgtccctgaagtgctggataccggaatctacgacgaagta
ttcaaggtttccggtgacgacgccatgaacaccgcacgcgacctgctgcgtcaggaaggt
attctgtgcggcatttcctcgggggcaaatgcatttgccgcactggaagcggccagacgg
cccgaaatgaaaggcaagcgcatcgtattcattgtctgcgacaccggcgaacgctacctg
agcacaccgcttttttccggccagagctag

DBGET integrated database retrieval system