KEGG   Desulfovibrio alaskensis: Dde_3084Help
Entry
Dde_3084          CDS       T00294                                 

Definition
(GenBank) diguanylate phosphodiesterase metal dependent hydrolase domain-containing protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HDOD EAL
Motif
Other DBs
NCBI-ProteinID: ABB39878
UniProt: Q30WR8
Position
3072872..3074131
Genome map
AA seq 419 aa AA seqDB search
MSENSRTASHRPVFFSKQPIMDSDRRIWGYELLGGEIQQGIFTVFPEHEAAATSLGSSAY
FRLQEDMDRGKRVMVAFDAESIILGIPRALPAKAGVVRVSQEATKTEGVPEELRALKKDG
YTIAIDCSHANRPDKECMLLADVVCVDFSVKAAVIACSRGDASSTMLARGIRDNDMFEAA
RRMGVGLYQGPFFKEPEITEGQGLSSHKVARIELMAILESPDPDLKGVAEAVKADVSLTF
RLISLLNSSAFGFRQKIESVDHAVNLLGWNQTRSWLRAVLVADMAGQSEGSQELALISMQ
RARFLQQLTAHYDYWGFNPETLFLLGMFSLLDAILGIPMQEVTDMLPLTSSLKESLTGDP
NNEHRPLFDLMEALEDADWNTLHEMVPRLGFEPDVVRSLYSEAMDWAASFFAVQSGPTA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaaacagccgaactgcatcacaccgtcctgtttttttttcaaagcagccgata
atggactcggaccgccgcatatggggatacgaactgctgggcggagaaatccagcaggga
attttcaccgtattcccggagcacgaggcagccgcaaccagtcttggttccagcgcctac
ttccgtctgcaggaagacatggaccgcggcaaacgcgtcatggtcgcatttgatgccgaa
agcatcattctgggcataccgcgcgcactgccggccaaggcgggtgttgtgcgggtctcg
caggaagcgaccaagacagagggcgtgcccgaagaactgcgtgcgcttaaaaaagacgga
tacaccattgccatagactgctcgcacgccaacagacccgacaaggaatgcatgctgctt
gccgatgtggtctgcgttgatttttccgtcaaggcggccgtcatcgcatgcagccgcggc
gatgcttccagcaccatgcttgcccgcggcatccgcgacaacgacatgttcgaagccgcg
cgcagaatgggcgtggggctgtatcagggaccttttttcaaagaaccggaaataacggaa
ggacagggactgtcttcgcataaagtggcccggatagagctgatggccattcttgaatcg
ccggaccccgacctgaaaggcgtcgcagaggctgtaaaggccgatgtgtcgctcacattc
cgccttatttcgctgctcaacagctccgcattcggattccggcaaaaaatcgaatctgtg
gaccatgccgtaaatctgctggggtggaatcagacccgctcgtggctgcgggccgttctg
gtggccgatatggcaggtcaatccgaaggttcacaggaacttgcgctcatctccatgcag
cgggcgcgctttctgcagcagcttaccgcccactacgactactggggcttcaaccccgaa
acactttttctgctgggcatgttctcgctgctggatgccattctgggtattcccatgcag
gaagtgacagacatgctgccgctgacctccagcctgaaggaaagcctgacaggcgacccc
aacaatgagcaccgcccgctttttgaccttatggaggcgctggaagacgcagactggaac
acgctgcacgaaatggtgcccagactcgggtttgagcctgatgtggtcagaagcctgtac
tccgaagccatggactgggctgcatcgttttttgccgtgcaaagcggccccaccgcgtaa

DBGET integrated database retrieval system