KEGG   Desulfovibrio alaskensis: Dde_3088Help
Entry
Dde_3088          CDS       T00294                                 

Definition
(GenBank) glycogen/starch/alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00500  Starch and sucrose metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dde_3088
Enzymes [BR:dde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Dde_3088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ABB39882
UniProt: Q30WR4
Position
complement(3076705..3079176)
Genome map
AA seq 823 aa AA seqDB search
MSRVCKMSKNVREVFRLDELKDDIRRNMVALLGNDPRSKRKFSYYNALAYSVRERLVDLW
MRTQSDYYDSMAKRVYYLSMEFLPGRFLMNYLTNMGIVDECREIVAELGFSLEELEEEEW
DAGLGNGGLGRLASCYLDSMVSQNIPGYGYGILYDYGIFYQSIVNGNQEERCDNWRRHGC
PWEITRLDTLYEVKFYGRSETYYDSDGNVRFRWVDTENVMAMPCDILIPGYGCSHVSNMR
LWTAQSSREFNLSDFNRGDYIGAMHGKVMSENITKVLYPNDQFLQGMELRLKQQYFLVSA
TFQDILRRYLKQHTSLAALPEAVAVQLNDTHPAIAIPELMRLLMDVYGMGWDVAWDICTR
TFAYTNHTVLPEALETWPVDLLGRLLPRHMQIIYEINRRFLEGVAATFPGDTERLSRMSV
IQEEGGQRVRMANLAIVGSHTVNGVAALHSNILQTGLFRDFHEYYPRKIRNVTNGVTPRR
WLMQCNPALSRLITQSIGPEWCCNLEKLRELVPLAEDSAFRDAWARAKLENKRLLSRYVL
RKVQMGINPNTLFDMQFKRMHEYKRQLLNVMHVISLFNRIKDNPSADITPRTVLFGGKAA
PGYYQAKLIIRLINEVARVVNADADVAGRLRVAFLPNYCISQAEKVVPAADLSEQISTAG
MEASGTGNMKFALNGALTIGTLDGANVEIMEEVGAENIFIFGLKAHEVAEKRRSGYNPRE
FYENDAELRRVMDMIGSGFFSPDERGLFSPVYDSLMHHGDYYMLMADYRPYMEAQAAVDA
LYLDQDQWVRKSILNAANMGKFSSDRSVMEYARGIWHVEPLGK
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgagtctgcaagatgagcaagaacgtcagggaagtcttcaggcttgatgaactg
aaagacgatatcaggcgcaacatggtggcgctgctgggcaacgatccgcgcagcaagcgc
aagttttcgtattacaacgcgctggcgtacagcgtgcgcgagcgtctggtcgacctgtgg
atgcggacccagagcgattattacgattccatggccaagcgggtgtattatctttccatg
gaatttctgcccggccgctttctgatgaactaccttaccaacatgggcatagtggatgag
tgccgcgagattgtggccgagctgggtttttcgctggaagagctggaagaggaggaatgg
gatgccggtctgggcaacggcgggctggggcgtcttgcctcgtgttatctcgattccatg
gtcagccagaatattccgggatacgggtacggtattttgtatgactacggcatattctat
cagtccatcgtgaacggcaatcaggaagagcgctgcgacaactggcgcagacacggatgc
ccgtgggagataacccgccttgacacactgtacgaggtgaagttctacggccggtccgaa
acttactacgactctgacggcaatgtgcgtttccgctgggtggatacggaaaatgtcatg
gccatgccgtgcgacattctcattcccggatacggttgctcgcatgtttccaacatgcgg
ctgtggactgcgcagtccagccgcgaattcaacctgtctgattttaaccgcggcgattat
ataggggccatgcacggcaaggtgatgagcgaaaacatcaccaaggtgctgtatcccaac
gatcagtttctgcagggaatggaactgcggctcaaacagcagtattttctggtttccgcc
acgtttcaggatatcctgcgccgttatctgaagcagcatacatcgcttgccgcactgccg
gaggcggttgcggtgcagcttaacgacacacaccccgccatagccatacccgaacttatg
cgtctgcttatggacgtgtacggcatgggctgggatgtggcgtgggatatctgcacccgc
acctttgcctataccaaccacaccgtgctgcccgaagcgctggaaacatggcctgtggac
ctgctgggcaggctgctgccgcggcatatgcagataatatatgaaataaacagacgtttt
ctggaaggtgtggccgcaacatttcccggtgataccgagcgcctttcacgcatgtctgtc
attcaggaagaaggaggccagcgggtgcgcatggccaaccttgccattgtgggcagccat
acggtgaacggcgtggcggcgctgcacagcaatatactgcagaccggtctgttccgtgat
tttcatgaatattatccgcgcaagatacgcaacgtgaccaacggcgtcacgccgcggcgg
tggcttatgcagtgcaatcctgctctttcgcggctgataacccagagcatagggccggaa
tggtgctgcaatcttgaaaaactgcgcgaacttgtacctctggcggaagacagtgcattc
cgcgatgcatgggcaagagccaagctggaaaacaaaagactgctgtcgcgttatgtgctg
cgcaaagtgcagatgggcatcaatcccaacacgttgtttgatatgcagtttaaacgcatg
cacgaatacaagcggcagctgctcaacgtgatgcacgtcatctcgctgttcaaccgcatc
aaggataacccctcggcggacatcacaccgcgcacggtgcttttcggcggcaaggcagcc
cccggatattatcaggccaagcttatcatcaggctgatcaacgaagttgcccgcgtggtc
aacgccgatgcggatgtcgccggcaggctgcgcgtggcttttctgcctaattactgcata
tcgcaggcggaaaaggtggtgcctgccgctgacctgtccgaacagatatccaccgccggc
atggaggcttccggcacgggcaatatgaagtttgcgcttaacggagcgttgaccataggc
acgctggacggtgccaatgtggaaataatggaggaagtgggagccgaaaatatttttata
ttcggcctcaaggcgcatgaagtggcggaaaaaaggcgttccggatacaacccccgggaa
ttttatgaaaacgatgcagagctgcgccgggtgatggatatgatcggttcgggctttttt
tctcccgacgaacgcgggttgttcagccctgtgtatgacagcctgatgcaccacggcgac
tattacatgcttatggccgattaccgtccctacatggaggcgcaggccgctgtggacgcg
ctgtaccttgatcaggaccagtgggtacgcaagtccattctcaatgccgccaacatgggt
aaattttccagcgaccgttcggtcatggagtatgcccgcggcatctggcatgtggagcct
ctcggcaaatag

DBGET integrated database retrieval system