KEGG   Desulfovibrio alaskensis: Dde_3092Help
Entry
Dde_3092          CDS       T00294                                 

Definition
(GenBank) heat shock protein Hsp20
  KO
K13993  HSP20 family protein
Organism
dde  Desulfovibrio alaskensis
Brite
KEGG Orthology (KO) [BR:dde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dde03110]
    Dde_3092
Chaperones and folding catalysts [BR:dde03110]
 Heat shock proteins
  HSP20
   Dde_3092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP20
Motif
Other DBs
NCBI-ProteinID: ABB39886
UniProt: Q30WR0
Position
complement(3081565..3081981)
Genome map
AA seq 138 aa AA seqDB search
MAIDFSSFYEFPHLLDRMTGEMDHAFAGGAPRQAAFPPLNIGEDDSAVYVRALVPGAGMD
DLELIITDKTLSLKGELKPVQGRYYRQERPTGPFQRVITVGVPIDRDAVRATLRNGVLEV
VLPKHTGQRPQTIRIDIR
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggccatagatttcagttcgttttatgagtttccgcatctgctcgaccgcatgaccgga
gagatggatcacgcctttgccggtggtgcgccgcggcaggctgcttttccgccgttgaac
ataggcgaggatgacagcgccgtgtatgtgcgcgcgctggtgcccggtgccggtatggac
gaccttgagctgataattaccgacaagacattgtcgctcaaaggcgaactgaaacccgta
cagggacgctattaccggcaggaacggcccacgggaccgtttcagcgggtaatcaccgtg
ggggtgcccatcgacagagacgccgtgcgtgccacgctgcgcaacggtgtgctggaagtg
gtgctgcccaaacataccggtcagcgtccccagaccatcagaatagatatacgttaa

DBGET integrated database retrieval system