KEGG   Desulfovibrio alaskensis: Dde_3094Help
Entry
Dde_3094          CDS       T00294                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
dde  Desulfovibrio alaskensis
Brite
KEGG Orthology (KO) [BR:dde00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dde_3094
Enzymes [BR:dde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Dde_3094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP KfrA_N PHP_C DUF4542
Motif
Other DBs
NCBI-ProteinID: ABB39888
UniProt: Q30WQ8
Position
3082490..3083359
Genome map
AA seq 289 aa AA seqDB search
MTACRYIDLHTHSTASDGSDTPAAVITKAHAAGLAAVALTDHDTLDGLDEAAETAGRLGV
ELVRGCELGAMCPYGEVHILGLWLPETPKALLRTLAELRQGRHDRNVKIVDKLRALGMNI
TYDEVRDVAGEGSVGRPHIAQVLVQKQVAGSTRQAFDMYLGDRGAAYVPRKSLSPEGAVK
ALKAEGATVSFAHPMLINAPDDWLEETVASLTAAGLDAIEAYHSEHSQKDIRRCVELADR
YGLALTGGSDYHGSVKPDISLGTGKGGLRVPYLILEKLKAARTANGLPV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcttgccgctatatagacctgcacacccattccaccgcatccgacggcagcgac
accccggccgcagtaataacaaaggcacacgccgcgggacttgccgccgtggcattgaca
gaccacgacacgctggacggtctggatgaagcggcagaaaccgccggccggctgggtgtg
gagcttgtccgcggctgcgaactgggagccatgtgcccctacggagaagtccatattctc
gggctgtggctgcccgaaaccccgaaggcgctgctgcgcacgctggcggaactgcgtcag
ggacgtcatgaccgcaatgtgaaaattgttgataagctgcgtgctctgggcatgaacatc
acctatgacgaggtgcgcgatgtggcgggagaaggttccgtgggcagaccgcacatagcg
caggtgctggtgcagaagcaggttgccggttccacccggcaggcctttgacatgtatctg
ggcgacaggggagcggcctatgtgccacgcaaatcgctttcgcccgaaggtgccgtcaag
gcgctgaaggccgaaggcgccaccgtatcctttgcccatcccatgctcataaacgcccct
gatgactggctggaagaaacagtggcatcactgacagcggcagggctggacgccatagaa
gcctatcacagcgaacattcccagaaagacatccgccgctgcgtggaactggcggaccgt
tacgggcttgcgcttacgggcggttcggactaccacggcagcgtcaagcccgacatatcg
ctgggcacgggcaagggtggcttgcgcgtgccgtatcttatactcgaaaaactgaaggcg
gcccgcacagcaaacggactgcctgtctga

DBGET integrated database retrieval system