KEGG   Desulfovibrio alaskensis: Dde_3099Help
Entry
Dde_3099          CDS       T00294                                 

Definition
(GenBank) methylated-DNA/protein-cysteine methyltransferase
  KO
K07443  methylated-DNA-protein-cysteine methyltransferase related protein
Organism
dde  Desulfovibrio alaskensis
Brite
KEGG Orthology (KO) [BR:dde00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Dde_3099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_binding_1
Motif
Other DBs
NCBI-ProteinID: ABB39893
UniProt: Q30WQ3
Position
3088591..3088908
Genome map
AA seq 105 aa AA seqDB search
MERTQFTVEVIRQIKSIPAGYVSTYGMIAAMAGNPRAARQVARVLHSCSARDALPWYRVI
NAGGNISLPRGGGYERQKALLQREGIVFDETDRVDLQRFMWTMPA
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagaacacagttcaccgttgaggtaatacgccagataaaaagcattccggcagga
tacgtgagcacgtacggaatgattgccgccatggcgggaaacccgcgggcagcacggcag
gtggccagagtgctgcatagctgttccgcccgtgacgctctgccgtggtaccgcgtcatc
aacgccggcgggaacatatcgctgccccgcggcggcgggtacgaacgtcagaaagccctg
ctgcagcgggagggcattgtctttgacgaaacagaccgcgtggacctgcagcgttttatg
tggacaatgccggcatga

DBGET integrated database retrieval system