KEGG   Desulfovibrio alaskensis: Dde_3103Help
Entry
Dde_3103          CDS       T00294                                 

Definition
(GenBank) Sirohydrochlorin cobaltochelatase
  KO
K02190  sirohydrochlorin cobaltochelatase [EC:4.99.1.3]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00860  Porphyrin and chlorophyll metabolism
dde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dde_3103
Enzymes [BR:dde01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.3  sirohydrochlorin cobaltochelatase
     Dde_3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiK CbiX Ferrochelatase
Motif
Other DBs
NCBI-ProteinID: ABB39897
UniProt: Q30WP9
Position
3093862..3094752
Genome map
AA seq 296 aa AA seqDB search
MKLRSWCRLLVTACCLLCVAAPAFAGHGAAHPDKKAILLATFGSTVPEARAPYEALEREV
RAAIPGVEVRWAYTARMVRDIVASEQNLQVDSPAVALGRLGDEGFNRVAVQSLHMIPGFE
YLGLLHTAERFEGMPKNIKQVEVGKPLMYTAEDMKNVADAVMTAVPAERTADEAVVFMGH
GTGHSANAFYPALQYYLWQKDANAFVGTVEGSPEIDDVLAMLKKKGIKKAYLLPLMSVAG
DHTVNDMAGDEPDSWKSVFAAHGITPVPVVKGMAAVPAIRAIWVEHLKEAYNRLDD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcgctcatggtgcagactgctcgtcaccgcgtgctgcctgctgtgcgttgcc
gcgcctgcttttgccggccacggcgccgcacatcccgacaaaaaagccattctgcttgcc
accttcggcagcaccgtgcccgaagcacgcgccccctacgaagcgctggaacgcgaagtg
cgtgccgccatacccggtgttgaagtgcgctgggcttacacggcacgcatggtgcgcgac
attgtggcgagtgagcagaacctgcaggtggattcgcccgccgtggcactgggccgtctg
ggcgatgaagggttcaaccgcgtggccgtgcagtcgctgcacatgattccgggctttgaa
tacctcggcctgctgcacaccgcagaacgttttgagggcatgcccaaaaatatcaagcag
gtggaagtcggcaagccgctcatgtacactgcagaggacatgaaaaatgtggccgatgca
gtcatgaccgccgtacccgcagaacgtaccgcagacgaggcggtggtgttcatgggccac
ggtaccggtcattctgccaatgcattctaccccgccctgcagtattatctgtggcagaaa
gatgccaatgcctttgtgggcaccgttgaaggcagccccgaaattgacgacgtgctggcc
atgctgaaaaagaaaggtatcaaaaaagcctacctgcttccgctcatgtcggtggcgggt
gaccataccgtaaacgacatggcaggcgacgagcccgattcgtggaaaagtgtttttgcc
gctcacggcatcacccccgtacccgtggtgaaaggcatggcagctgtgcccgccatccgc
gccatatgggttgagcaccttaaagaagcctacaaccggctggatgactga

DBGET integrated database retrieval system