KEGG   Desulfovibrio alaskensis: Dde_3109Help
Entry
Dde_3109          CDS       T00294                                 

Definition
(GenBank) protein of unknown function DUF124
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIM24
Motif
Other DBs
NCBI-ProteinID: ABB39903
UniProt: Q30WP3
Position
complement(3099442..3100170)
Genome map
AA seq 242 aa AA seqDB search
MESHEVEYRITGGDLQVVEVELDPGETVIAEAGAMCWMDGDIEFAARMGDGSAADGGFFG
KLLGAGKRLVTGESLFMTHFTNQGQAKASVAFAGQVPGHVVPVDLAEIGGELICQRDAFL
CAARGTRIDVAFSKRLGAGFFGGEGFVLQRLRGDGLAFVHAGGAVVRKELHGGTLRVDTG
CLVAFTPGVSYDIGLSGGLKSMMFGGEGAFLAALSGHGTVFLQSMPFNRLADRITALIPE
KK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggaaagccatgaagtggaatacaggataacggggggcgacctgcaggtggtggaagtg
gaactggaccccggtgagacagtcatagccgaagccggagccatgtgctggatggacggg
gacattgagtttgccgcccgcatgggcgacggttccgcggcggacggcggttttttcggc
aagctgctgggagcgggcaagcggctggtcacgggtgagtcgctgtttatgacgcacttt
accaatcaggggcaggcaaaggcctccgtggcttttgccggtcaggtgccggggcatgtg
gtgcctgttgatctggcggaaatcggcggcgagcttatctgtcagcgcgatgcttttttg
tgcgcggcgcgcggcacccgcatcgatgtcgctttcagcaagcgtctgggagcgggattt
ttcggtggtgaaggatttgtactgcagcggctgcgcggtgacggtctggcctttgtgcat
gcgggcggcgccgtggtgcgcaaggaactgcacggcggtacgctgcgggtggacacaggc
tgcctcgtggctttcacaccgggggtcagctacgatatcggactttccggcgggctgaag
tccatgatgttcggcggcgaaggggcgtttctggcggcattgtccggacacggtacggtg
tttttgcagagcatgcccttcaaccgtcttgccgaccgtatcacggcactgattcctgaa
aagaaataa

DBGET integrated database retrieval system