KEGG   Desulfovibrio alaskensis: Dde_3123Help
Entry
Dde_3123          CDS       T00294                                 

Definition
(GenBank) hypothetical protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABB39917
UniProt: Q30WM9
Position
3114360..3114935
Genome map
AA seq 191 aa AA seqDB search
MARSRDAHICARCAAHSGTCCRMQPGNEELCFPLSRSEWQRIVEHCNDKGGFASQPNTKP
FLQCMKRLFPADEKRLEAIFPPHGEHLRLASDNEGRCLFLSAAGCTLPRETRPWYCRLFP
FWFMPNGMLTMFTPDECLVYLESRSVRDAMQELGVTENELRLMFGRLRLAWGLDPEHDED
GNRYPLCDHTR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggccagaagccgtgatgcacatatatgcgcccgctgtgccgcacattccggcacctgc
tgccggatgcagcccggcaatgaagagctgtgctttccgctttcgcgcagcgaatggcag
cgcattgtggagcattgcaatgacaagggcgggtttgccagccagcccaatacaaaaccg
ttcctgcagtgtatgaaacgcctttttcccgccgatgaaaaacggctggaggccattttt
ccccctcacggggagcatctgcgccttgcctcggacaatgaaggccgctgccttttcctt
tccgctgccggctgcactcttccccgcgagacacgtccgtggtattgccgcctgttccct
ttctggtttatgcccaacggcatgctgaccatgttcactccggacgagtgtctcgtctat
ctggagtcacgctccgtcagagacgccatgcaggaactgggcgttacagaaaacgaactg
cgcctgatgttcggccgcctgcgacttgcgtgggggcttgatccggagcatgacgaagac
ggcaaccgctatccgctttgcgaccatacccgataa

DBGET integrated database retrieval system