KEGG   Desulfovibrio alaskensis: Dde_3124Help
Entry
Dde_3124          CDS       T00294                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00550  Peptidoglycan biosynthesis
dde01100  Metabolic pathways
dde01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dde_3124
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Dde_3124
Enzymes [BR:dde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Dde_3124
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Dde_3124
Glycosyltransferases [BR:dde01003]
 Polysaccharide
  Bacterial polysaccharide
   Dde_3124
Peptidoglycan biosynthesis and degradation proteins [BR:dde01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Dde_3124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ABB39918
UniProt: Q30WM8
Position
3114943..3117366
Genome map
AA seq 807 aa AA seqDB search
MKRFLTYFLVSVTGLALLGMLGLGGIYIWATKDLPGFTRITDYRPPLVTTVYARDNSILG
YFYREKRFLARLDEMPQHLPLAFLAAEDDSFYRHEGIDFRAILRAFMKNMQAGTIRQGGS
TITQQVIKRLLLTSERSYERKIKEAILAYRLERYLSKDEILTIYLNQIYLGAGAYGVEAA
ARSYFGKHVGELSIAESALLAGLPQAPSKYNPLNNPQDAYTRQLYVLHRMLQLGWITPSQ
YDAAINEKLVFTSMADPSWGTGAWYLEEVRRRLIDYLSEDNMEKLGIKLERYGEDAVYES
GLHVYTAMDPKHQKYAEQSLRDGLVASTKRRGWRGPVEHLESKEAREAFLRDNPVDAAAM
QHEGWIKVLVTRVTAAGADVRFGSYKGRMDVETMHWCRTPDPTVVTDYVPAVKDARTVVK
AGDVVWAQLMLPDAGKSFDAASVTPDTDFSLAIAQYPEVQGALVSIEPQTGDVVALVGGY
SFADSQYNRAVQAKRQPGSAFKPIVYSTALDNGYTPASTVLDAPFVYTDDATAKTWRPEN
FSGEFYGPTLLRTALVKSRNLCTIRIAQDIGIPAIVERAKALGLEGPFPFDLSVSLGSVA
VSPLNLTEAYTAFAHEGLRAQHRMITGIKSAWDEPIATFEPQQTEALTPQNAYIMASLMK
EVVRDGTGFRARVLKRPLGGKTGTSNDERDAWFVLISPYLVSVSYVGFDDLTPMGKWETG
SRAASPIVVGYRQGVEEDYPVQDFPMPPGIVQVRIDGKTGNLAGPGSETSYFMPFKEGTQ
PTVVEGSAPRHGADDARSGEDLMKQMF
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttttctcacatactttcttgtcagcgtcacaggtcttgccctgctgggcatg
ctcgggctgggcggcatctatatatgggccaccaaagacctgcccggctttacccgtatc
accgattaccgcccgccgctggtcaccacggtgtacgcgcgcgataacagcattctgggg
tatttctaccgcgaaaaacgctttctggcgcgccttgatgaaatgccgcagcatctgcct
ctggcctttctcgccgcagaggacgactccttttaccggcatgaaggcatagacttccgc
gccattctgcgcgccttcatgaaaaacatgcaggcaggcaccatccggcagggcggttcc
accatcacacagcaggtcatcaaacgcctgttgcttacttccgaacgcagctacgagcgc
aagataaaagaagccattctggcctaccggctggaacgctatctgagcaaagatgaaatt
ctgaccatatacctgaaccagatatatctcggcgcgggggcatatggcgtggaagccgcc
gcgcgcagctacttcggcaaacatgtgggcgaactgtccatagccgaatctgcgctgctg
gccggtctgccgcaggctccttccaaatacaacccgctcaacaacccgcaggacgcatac
acccgtcagctgtatgtgctgcaccgcatgcttcagctcgggtggataacaccctcgcaa
tacgacgcggccatcaatgaaaagcttgtgttcacctccatggccgatccttcgtggggc
accggcgcatggtatctggaagaagtgcgccgcaggctcatcgactatctgagcgaagac
aacatggaaaaactgggcatcaagctggaacgctacggcgaggacgccgtgtatgaatcc
ggcctgcatgtttacaccgccatggaccccaagcaccagaagtacgccgaacagtcactg
cgcgacgggctggtggcctctacaaaacggcggggctggcgcggccctgtggagcatctg
gaaagcaaggaagcacgcgaagcttttctgcgtgacaaccccgtggatgcggcggcaatg
cagcacgaaggctggataaaagtgctggtcacccgcgtgacggccgcaggggccgatgtg
cgctttggcagctacaagggccggatggacgtggaaaccatgcactggtgccgtacgccc
gaccccaccgtggtgacggactatgtgcccgccgtgaaagatgcccgtacggtggtcaaa
gcgggcgatgtggtatgggcgcagcttatgctgcccgatgcgggcaaaagctttgatgcc
gcctccgtcacgcctgatacggacttttcactggccatcgcgcagtaccccgaagtgcag
ggggcactggtttccatagaaccgcagacgggcgatgtggtggcactggtcggcggctat
tcctttgccgacagccagtacaaccgcgccgtgcaggccaaacgccagcccggttccgct
ttcaagcccattgtctattccaccgcgctggacaacggctacacaccggcatccacggta
ctggacgccccgtttgtctataccgacgacgccacggccaaaacatggcgccccgaaaac
ttttcgggagaattctacggccccacgctgctgcgcaccgcgctggtcaaatcgcgtaac
ctgtgtaccatccgcattgcacaggacatcggcataccggccattgtcgaacgggccaaa
gcactgggacttgaagggcccttccccttcgacctttcggtaagtctggggtctgtggcc
gtttcgcctctgaaccttacagaagcatacacggcgttcgcccatgaaggtctgcgcgca
caacaccgcatgatcaccggcatcaaatcggcatgggacgaacccatagccacctttgag
ccgcagcagacagaagcgctgacaccgcagaacgcctatatcatggcgtcgctgatgaaa
gaggtagtgcgcgacggcaccggcttccgcgcacgggtgctcaaacgtcctctgggcggc
aaaaccggcacatccaacgacgagcgtgacgcatggtttgttctcatctctccgtacctt
gtctcggtgtcctatgtgggctttgacgacctgacccccatgggcaaatgggaaaccggc
tcgcgggcggcatcgcccattgtggtcggctaccgtcagggtgtggaagaagactacccc
gtacaggattttcccatgcctcccggcatcgtgcaggtgcgcattgacggcaaaacagga
aatcttgcgggacccggctctgaaacaagttacttcatgcctttcaaggaaggaacccag
cccaccgtggtggaaggttccgccccccgccacggcgccgacgacgcccgcagcggcgaa
gaccttatgaagcagatgttctga

DBGET integrated database retrieval system