KEGG   Desulfovibrio alaskensis: Dde_3130Help
Entry
Dde_3130          CDS       T00294                                 

Definition
(GenBank) acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00290  Valine, leucine and isoleucine biosynthesis
dde00650  Butanoate metabolism
dde00660  C5-Branched dibasic acid metabolism
dde00770  Pantothenate and CoA biosynthesis
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01130  Biosynthesis of antibiotics
dde01210  2-Oxocarboxylic acid metabolism
dde01230  Biosynthesis of amino acids
Module
dde_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Dde_3130
   00660 C5-Branched dibasic acid metabolism
    Dde_3130
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Dde_3130
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Dde_3130
Enzymes [BR:dde01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Dde_3130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT ACT_4 ACT_5
Motif
Other DBs
NCBI-ProteinID: ABB39924
UniProt: Q30WM2
Position
complement(3123063..3123545)
Genome map
AA seq 160 aa AA seqDB search
MKHTISALVQNRVGVVAEATDVFRKYNVNIKSVSCGETEDFDVSRLVITVEGQSAEVERI
CAELSGLDFIREVEDLARKDFVDRELALLRVSITRDTMSQVMQIFEVFRANVVGMGQETI
TVELTGDQEKVDGFIKMLRPHGIRSLCRTGVIALRRGDED
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcataccatctctgcacttgtgcaaaaccgtgtcggtgtagtggcagaggctacg
gacgtgttccgcaaatacaatgtgaacatcaagtctgtctcctgtggcgagaccgaagac
tttgacgtgtcgcggcttgtgatcacagtggaaggccagtctgcggaagtcgagcgtatc
tgcgcggaactgtccggactggattttatccgcgaggtggaagatctggcccgtaaagat
tttgttgaccgcgaactggctttgctgcgggtttccatcacgcgcgacaccatgtcacag
gtcatgcagatttttgaggtattccgggcaaatgttgtgggtatgggacaggaaaccatc
actgtagaactgaccggtgatcaggaaaaggtggacggtttcatcaagatgctgcggcct
cacggcatccgcagcctgtgccgtaccggtgtcattgcgttgcgtcgcggcgatgaagac
tga

DBGET integrated database retrieval system