KEGG   Desulfovibrio alaskensis: Dde_3137Help
Entry
Dde_3137          CDS       T00294                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_N HTH_18 HTH_AraC SatD
Motif
Other DBs
NCBI-ProteinID: ABB39931
UniProt: Q30WL5
Position
complement(3128276..3129160)
Genome map
AA seq 294 aa AA seqDB search
MSGMVKLLDEIAGVDGGVVESRLPGVRFFKETRHVARRPMLYNPGICIVVSGHKVAYVGG
QTFRYDVDNYLVTSVAMPFECESFPSQENPLLGMFIDIDIGQLNNLISMMERQDNPSVAV
SNGRQLAIGPSAMDADMKDAAVKLVKALQSEQEARILGPGLVREVYYRALCGNQAPVLYS
LVRGSGSFSQVARIIHMMEGSYSEKFDIQQLADSVHMSVSAFHKAFKDITADSPLQYLKK
IRLSRARDLIVQQGMKAYLAADEVGYESPSQFSREFKRYFGRSPAELMRDVRSS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtatggtgaaactgcttgatgagattgccggtgtcgacggcggcgttgttgag
tccaggcttccaggtgtccgtttttttaaggagacaaggcatgtagcacgcaggccgatg
ctgtataatcctggaatatgtatagtcgtatcaggacataaagtggcgtatgtcggcggt
cagactttcagatacgatgtggataactatcttgtgacttcggtcgccatgccgtttgag
tgcgaatcctttcccagtcaggaaaacccgttactggggatgtttatcgacattgacatc
gggcagctgaataatctgataagtatgatggaaaggcaggataatccgtctgtggcagtt
tctaacgggcggcagcttgccattggcccttcggctatggacgcggatatgaaagacgct
gctgtgaagttggttaaagcactgcagagtgaacaggaagccagaatactggggccgggg
ctggtacgcgaggtgtattacagagcattatgcggaaatcaggctcccgtgttgtattct
cttgtgcggggaagcggttctttttcgcaggtggccagaattatacacatgatggaaggc
agctactctgaaaaatttgatattcagcagcttgcagattccgtgcatatgagtgtttct
gcttttcataaggcgttcaaggatattacggcagattcgccgttgcagtatttaaagaaa
atacgactttcgcgcgccagagaccttatcgtccagcagggaatgaaagcttatctggca
gcagatgaggtcggatacgaaagtccgtctcagttcagccgcgaattcaaacgttatttc
gggcgcagtcccgcagagctaatgcgtgatgtccgttcatcgtag

DBGET integrated database retrieval system