KEGG   Desulfovibrio alaskensis: Dde_3138Help
Entry
Dde_3138          CDS       T00294                                 

Definition
(GenBank) membrane protein
  KO
K06889  uncharacterized protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S15 DLH BAAT_C Hydrolase_4 AXE1 RMMBL Peptidase_S9 Abhydrolase_7
Motif
Other DBs
NCBI-ProteinID: ABB39932
UniProt: Q30WL4
Position
3129460..3130416
Genome map
AA seq 318 aa AA seqDB search
MTWDKTFKPSAQVLHKKVIYPNRYGILISADMYMPRTMDPNRQLPALIVGTPYGGVKEQG
AGIYAQTMAERGFVAIAFDESFNGESGGNPRHISSPEIFTEDFSAGVDFLGTTPFVDREK
IGVIGICGSGAFALKAAQADRRIKAVATASMYDMSRVTRYGWLDSLSDEERNTMLDELGM
QRWKDFESKAPLLPAGFPDTPSDSIPQGLDPISSEFWEYYAMKRGHHPRSHGPFTVTSNM
AFINFPLLDFIETISPRPILFIIGEKAHSRYFTEDAYKMAEEPKELFIVPEARHIDLYDR
MDIIPFGKLDDFFKKALG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacctgggacaaaacgttcaagccaagtgcacaagtacttcataaaaaagtcatctat
cccaacagatacgggattctcatctctgccgacatgtacatgccgcgtactatggaccca
aaccggcagcttccggcgctcattgtcggcacaccctacggcggagtgaaggaacaaggc
gcaggtatctacgcacagaccatggcggaacgcggctttgtagccattgcgtttgacgaa
tcctttaacggcgaaagcggcggcaaccccagacacatatcctctcctgaaatttttacg
gaggacttcagtgcgggcgttgattttttgggcacaacaccttttgtggacagagaaaaa
atcggcgtcataggaatctgcggcagcggagcatttgcccttaaagccgcacaggctgac
cgccggattaaagccgtcgcgaccgccagcatgtatgacatgagtcgggtaaccaggtac
ggttggcttgattctttgtcggacgaagaacgcaatacaatgctggatgaactcggaatg
caacgctggaaagattttgagagcaaagcaccactactgccggcaggctttccggacacc
ccaagcgattcgatcccgcagggactggaccccataagcagtgagttctgggaatactac
gccatgaagcgggggcatcatccccgttcacacggaccgtttacagtaacaagcaacatg
gctttcataaacttccctctgctggatttcatcgaaacaatatcgccccgccctattctg
ttcattatcggcgaaaaggcacactcgcgttactttacagaagacgcttacaaaatggct
gaagaaccgaaagagctctttatcgttcccgaagcaagacatatcgacctgtacgaccgc
atggacataattccttttggcaaactggatgactttttcaaaaaagcccttgggtaa

DBGET integrated database retrieval system