KEGG   Desulfovibrio alaskensis: Dde_3141Help
Entry
Dde_3141          CDS       T00294                                 

Definition
(GenBank) NADPH-dependent FMN reductase
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_5
Motif
Other DBs
NCBI-ProteinID: ABB39935
UniProt: Q30WL1
Position
3131821..3132357
Genome map
AA seq 178 aa AA seqDB search
MSKTILCISSSPRAKGNSDLLCDAFMHGATEAGHTVEKVRLAEKNINYCTGCCSCIGGSG
VCAQQDDMADILGKLIAADVIVFATPVYFRSFNGPMKTFIDRVCPVYTHVSDKDVYFIIS
AAGGALPVESTEQSFRTFTGCLRNIREKGTISITGVWDEDSVKGTRALQQAHAAGSKA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaattctttgtatctcgtcgagccccagagcaaagggcaactctgacctt
ctgtgcgatgccttcatgcatggagcgactgaagccggacatacggtggaaaaggtccgc
cttgcggagaagaatatcaactactgcacagggtgctgcagctgtatcggcggctctggc
gtctgtgcgcagcaggatgatatggcagacattctgggcaagctgatcgctgccgatgtg
attgtttttgccacgccggtgtatttccggtccttcaacggccccatgaagacgttcatc
gaccgggtgtgtcccgtttacacgcacgtcagtgacaaggacgtgtattttatcatctcc
gcagctggcggtgccctgccggtggaaagcacggagcagagttttaggacgtttaccggg
tgtctgcgcaatatcagggaaaagggaacgatttccattactggcgtgtgggatgaagat
tcggttaagggaacccgcgcgctgcaacaggcacatgcggctggatcgaaggcctga

DBGET integrated database retrieval system