KEGG   Desulfovibrio alaskensis: Dde_3142Help
Entry
Dde_3142          CDS       T00294                                 

Definition
(GenBank) hypothetical protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclophil_like
Motif
Other DBs
NCBI-ProteinID: ABB39936
UniProt: Q30WL0
Position
3132398..3132844
Genome map
AA seq 148 aa AA seqDB search
MKNGVWFLVSLCVVMLFSVTVSFANETGEHPMQMVVHANGQDIVFALNESPASKSLLVQL
PMEIAVENYGNNEKIFYPPKKLNTSDTPLAGDVRSGTLAYYAPWGDVVMFYGSFHSAPGL
YELGHAVQGGEYIRELSGMIMVAADVSQ
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatggtgtatggtttctggtgtcactctgtgtcgttatgcttttttccgtaaca
gtctcttttgccaatgaaaccggagaacatcccatgcagatggtcgtacacgcaaatggt
caggatatcgtcttcgcattgaatgagagcccggcgtccaagtcattgcttgttcagtta
cccatggaaattgccgttgaaaactatgggaacaatgagaaaattttttaccccccgaaa
aaactgaatacgtccgacacgccgttggctggcgatgtgcgctccggcactctggcttac
tacgcaccctggggtgacgtggtgatgttctatggcagcttccattccgcgccgggcctg
tatgaactcggccacgccgttcagggcggtgaatatatccgggagttgtccggcatgatt
atggttgctgctgacgtttcgcaataa

DBGET integrated database retrieval system