KEGG   Desulfovibrio alaskensis: Dde_3155Help
Entry
Dde_3155          CDS       T00294                                 

Definition
(GenBank) flagellar P-ring protein
  KO
K02394  flagellar P-ring protein precursor FlgI
Organism
dde  Desulfovibrio alaskensis
Pathway
dde02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:dde00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    Dde_3155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:dde02035]
    Dde_3155
Bacterial motility proteins [BR:dde02035]
 Flagellar system
  Flagellar assembly proteins
   M,S,P and L rings
    Dde_3155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgI
Motif
Other DBs
NCBI-ProteinID: ABB39949
UniProt: Q30WJ7
Position
complement(3141669..3142781)
Genome map
AA seq 370 aa AA seqDB search
MTFFTRCFRRGALLFLLAVLLLPSPAQAVRIKDIASFGGVRDNDLMGYGLVVGLGGTGDK
KSSTFTISSMVNMLDKMGIAVDRTKLTPKNVAAVMVTTRMPVSARPGSRLDITVSSLGDA
TSLLGGVLLMTPMKGVDGKVYALAQGPLALGGFSAEGDAARAQKNITTVGRIPGGAVVER
AVPFEFNTQNKLTLHMNVQDFSTTMQVVDRLNDNMGGQFASARDIATVDIMVPPAYRGNL
VPLMASLENLPVTPDSPARVVVDEKTGTVVVGNSVRISKVAVSHGNLQIVVQENPQVSQP
GAFSPGQTVVTPQTDIAAQEENRRLVMMEGATLQELVDGLNSIGATPRDLISILRTLKAA
GALHAELEVI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccttttttacccgttgcttccgccgtggcgcgctgctttttctgctggctgtcctg
ctgctgccttcgcccgcccaggctgtacgcatcaaggacatagcctcgttcggcggtgtg
cgcgacaacgacctcatgggctacgggcttgtggtggggcttggcggtacgggtgacaaa
aaatcatccacgttcaccataagctccatggtgaacatgctcgacaagatgggcatagcc
gtggaccgcaccaagctgacacctaaaaacgtggccgctgtgatggtgaccacgcgcatg
cccgtgtcggcccgtccgggttcgcgtctggatattacggtatcatcgctgggagacgcc
accagtctgctgggcggcgtgttgctgatgacacccatgaaaggggtggacggcaaggtg
tatgcgctggcacagggaccgcttgccctgggcggtttttcggcggaaggcgatgcggcg
cgggcgcagaagaacatcaccaccgtgggccgcattcccggcggtgccgtggtggagcgt
gccgtgccgtttgaattcaacacccagaacaagctgacgctgcatatgaacgtgcaggat
ttttccacaaccatgcaggtggtggacaggcttaatgacaacatgggcggccagtttgcc
agtgcgcgcgatatagccaccgtggacatcatggtgccgcccgcctacaggggcaatctg
gtgccgctgatggcttcgctggaaaacctgcccgtaacgccggacagccccgcccgtgtg
gtggtggatgaaaagaccggaaccgttgtggtgggtaacagtgtgcggatttccaaggtt
gccgtgtcgcatggcaatctgcagatagtggtgcaggaaaatccgcaggtttcgcagccc
ggagccttcagcccggggcagaccgtggtcactccgcagacggatatagccgcacaggaa
gagaaccggcggctggtgatgatggaaggagccacgctgcaggaacttgtggacggcctg
aattccataggcgccacaccgcgcgatcttatttccatactgcgcacgctcaaagcggcg
ggcgcgctgcacgcggagctggaggtcatctag

DBGET integrated database retrieval system