KEGG   Desulfovibrio alaskensis: Dde_3174Help
Entry
Dde_3174          CDS       T00294                                 

Definition
(GenBank) ABC-type transporter, periplasmic subunit
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
dde  Desulfovibrio alaskensis
Pathway
dde02024  Quorum sensing
Module
dde_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:dde00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dde_3174
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dde02000]
    Dde_3174
Transporters [BR:dde02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Dde_3174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 DUF2510
Motif
Other DBs
NCBI-ProteinID: ABB39968
UniProt: Q30WH8
Position
3161454..3163025
Genome map
AA seq 523 aa AA seqDB search
MPESTARPHFAAARHMMGIAALFAAMLTVFAAFAPQPAAAAGSLVFARASDAVTLDPARA
PDLESTKVIANIYEGLVTVAESGTEIVPALARSWESSADGTRWTFHLRHGVVFHDGTPLT
AQAVVQSFMRQIDPERSDFAGDSGVSRFTFRHITAVSAPDDHTVLITLDAPFPPFLHNMS
MATASVISPAGGDIPAGTGPFRLHTWEKGRRIVLKAHTEYWRGAPQLDTVVLEVIPKASD
RLTALNVGAIDAFDGVTSDIARHASAQSSIQLSSRTGLRIAYLAMNTQKPPFDNPAVRRA
LNMAVNKIPMQTLIYGNTAVVAHNVIPETVWAYDETLPPYVYDPAAARDMLAQAGYPQGF
TATLYFCPRPFYPEGIEALIRNELAAVNVRLDIRYTEWTEHLKATGNAEHDMCIISWGGY
NSDPDNFFYPLFHPHNAVTPHAQNRAFYTNPQVSRLIEKAQQETDPGIRKEHYRRIQRLI
RNDAPWIPLVYNRELLAHSVDVTGLRLDATGVVRFYGAHVRHD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagtccacagcgcgtcctcactttgcggcggcgcggcacatgatgggcattgct
gcgctatttgcggcaatgctgaccgtttttgcggcgttcgccccgcagcccgcggccgcg
gccggttcgctggtttttgcgcgggccagcgatgccgtgactctggacccggcgcgcgca
ccggaccttgaatccaccaaggtcatcgccaacatatacgaagggctggtcaccgtggca
gaaagcggcacggaaatagtgcctgcgctggcccgttcgtgggaaagctccgccgacggt
acccgctggacattccacctgcggcacggggtcgtgtttcacgacggcacgccgcttacc
gcacaggccgttgtgcagtcgttcatgcggcagatcgatccggaacgttctgatttcgcc
ggagattccggcgtgtcacggtttacgttccgccacatcaccgccgtcagcgcccccgac
gaccacaccgtgctcataacgctggatgcgccgttcccgccttttctgcacaatatgtcc
atggccaccgcttcggtcatcagtcctgccggcggtgatattcccgccggtacagggcct
ttccgtctgcatacgtgggaaaaaggcagaagaatagtgctgaaggcccacacggaatac
tggcggggcgcccctcagctggataccgtggtgctggaggtcatacccaaagcatcggac
aggcttaccgcacttaacgtcggcgccattgatgcctttgacggagtgaccagtgacata
gcccgccatgcatcagctcaaagctccatacagctttccagccgtaccggtctgcgcata
gcctatctggccatgaacacgcaaaagcccccttttgacaatccggcagtgcgcagagct
ctgaacatggccgtgaataaaatccccatgcagactctgatctacggcaacaccgccgtg
gtggcgcacaatgtcattcccgaaacggtatgggcctatgacgaaaccctgcccccctat
gtctacgatcccgcggccgcgcgtgacatgctggcacaggccggttatccgcagggattc
accgccacgctgtatttctgtccgcgccctttttaccccgaaggaatcgaagctcttatc
agaaatgaactggcagccgtcaacgtgcgtctggatatccgctacaccgaatggaccgaa
cacctgaaagccaccggcaacgcggagcacgatatgtgcatcatcagctggggcggatac
aacagcgatcccgacaacttcttctacccgctgttccatcctcacaatgccgtgacaccc
catgcccagaacagggcgttttataccaacccccaagtcagccggctgatagaaaaagcc
cagcaggaaacagaccccggaatccgcaaggaacactaccggcgcatacaacggcttatc
agaaatgacgccccgtggattccgctggtctacaaccgcgaactgctggcgcattccgtc
gacgttaccggtctgcgcctggacgccacaggcgttgtgcggttttacggcgcccacgtc
cgccacgactga

DBGET integrated database retrieval system