KEGG   Desulfovibrio alaskensis: Dde_3179Help
Entry
Dde_3179          CDS       T00294                                 

Definition
(GenBank) Putative heme biosynthesis protein
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_24 HTH_AsnC-type MarR_2 HTH_Crp_2 HTH_27 HTH_28 Penicillinase_R Sigma70_r4_2 MarR HTH_29
Motif
Other DBs
NCBI-ProteinID: ABB39973
UniProt: Q30WH3
Position
3165816..3166292
Genome map
AA seq 158 aa AA seqDB search
MAQTFTDTERAILRIVQKNLPDSATPYADIAEQTGTDEQTVLALLRRMKEEGSIRRFGAS
LKHQKAGYTHNAMVAWIVDKDTVDEVGRQAAEHRLISHVYYRPSTAPDWPYTLYTMIHGR
HENEYLEVIDTLRKETALEEYAVLNSLKELKKTSMTYF
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggctcagacttttacagacaccgagcgcgccattctgcgcattgtgcagaagaacctg
ccggacagcgcaacgccgtatgccgatatcgccgaacagacaggcaccgacgagcagaca
gtgcttgctctgctgcgccgcatgaaggaagaaggctccatccgccgtttcggcgccagc
cttaagcaccagaaggcaggctacacgcacaacgccatggtagcatggattgtcgacaaa
gacaccgtggacgaagtgggcagacaggccgccgagcaccggctcatatcgcatgtctac
taccgccccagtaccgcgccggactggccttacacgctgtacaccatgatccacgggcgg
cacgaaaacgaatatcttgaagtgattgacaccctgcgcaaagaaactgcgctggaagaa
tatgctgtattgaacagcctgaaagaactgaaaaaaacctccatgacctatttctag

DBGET integrated database retrieval system