KEGG   Desulfovibrio alaskensis: Dde_3182Help
Entry
Dde_3182          CDS       T00294                                 

Definition
(GenBank) cytochrome c class III
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_CIII Cytochrome_C7 Cytochrom_NNT Cytochrom_c3_2
Motif
Other DBs
NCBI-ProteinID: ABB39976
UniProt: Q30WH0
Structure
PDB: 

Position
3169869..3170261
Genome map
AA seq 130 aa AA seqDB search
MRKSLFAVMVLALVAAFALPVIAAEAPADGLKMENTKMPVIFNHSSHSSYQCADCHHPVD
GKENLAKCATAGCHDVFDKKDKSVHSYYKIIHDRKATTVATCMSCHLEAAGSDKDLKKEL
TGCKKSKCHP
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaatcgctgtttgccgtaatggtgctggcactggtagccgcttttgcgctgccc
gtcatcgccgcggaagcacctgccgacggtctgaagatggaaaacaccaaaatgccggtg
atcttcaaccactccagccactccagctaccagtgcgccgactgccaccaccccgttgac
ggcaaggaaaatcttgccaagtgtgccaccgccggctgtcacgatgtttttgacaagaag
gacaagtctgtccattcttactacaaaatcatccacgacagaaaggccaccactgttgcc
acctgtatgtcctgccaccttgaagctgcaggcagcgacaaggacctgaaaaaggaactg
accggttgcaaaaagtccaagtgccacccctag

DBGET integrated database retrieval system