KEGG   Desulfovibrio alaskensis: Dde_3188Help
Entry
Dde_3188          CDS       T00294                                 

Definition
(GenBank) futalosine nucleosidase
  KO
K11783  futalosine hydrolase [EC:3.2.2.26]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00130  Ubiquinone and other terpenoid-quinone biosynthesis
dde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Dde_3188
Enzymes [BR:dde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.26  futalosine hydrolase
     Dde_3188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: ABB39982
UniProt: Q30WG4
Position
3175883..3176644
Genome map
AA seq 253 aa AA seqDB search
MHYKSTGTATRYTYHQMTLIITTATTREMEAVLKGFNGRGRVGCVLPRQGEVCASPVNER
QCLLAVTGVGPVNAAFTLGRLLGEHRNIDGVISLGIAGTFDPDAAPLGSTVLATRETWAD
YGLYTAQGVDPMGIGFGQTDDAVNPVWNSIELNPAPALAVLQLTPPPLCRTGGSLTVAAA
SGTAERACAMRQTHHALTENMEGFALALGCLRQGVPFLELRTVSNVVGSRAAHDWAVDDA
FASLGQAARALFV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgcactataaaagcaccggaactgcaacccgttatacctaccaccagatgacgctgatt
attaccaccgccaccaccagagaaatggaagccgtccttaaagggttcaacggcaggggc
cgcgtaggctgcgtgctaccccgtcagggtgaagtatgcgcatcgcccgtcaacgaacgt
cagtgtctgctggccgtgaccggtgtgggaccggtgaatgcggcctttacactgggccgg
ctgctgggcgaacaccgcaacatcgacggggttatctcgctgggtatagcaggcacattt
gacccggatgccgccccgctgggcagcactgtgctggccacgcgtgaaacatgggccgat
tacggcctgtatacggcacagggggtcgaccccatgggaatcgggttcggccagacggac
gatgccgtcaatccggtctggaacagtatagagctgaaccccgcgccggcactggccgtg
ctgcagttgaccccgccgcccctttgccgcacgggcggcagcctgacggtggccgccgcc
agcggtacggcggaacgcgcctgcgccatgcggcagacgcatcatgccctgacagaaaat
atggaaggctttgcgctggcgctcggctgtctgcggcagggtgtgccttttctggaactg
cgcacggtttccaatgtggtcggttcgcgcgcagcgcatgactgggccgtggacgatgca
ttcgcctcgctggggcaggccgcccgcgccctgtttgtctga

DBGET integrated database retrieval system