KEGG   Desulfovibrio alaskensis: Dde_3190Help
Entry
Dde_3190          CDS       T00294                                 

Definition
(GenBank) diguanylate cyclase with PAS/PAC sensor
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HDOD GGDEF PAS PAS_4 PAS_8
Motif
Other DBs
NCBI-ProteinID: ABB39984
UniProt: Q30WG2
Position
3177669..3180227
Genome map
AA seq 852 aa AA seqDB search
MTTQEAADRSKTMEWYSECLQLTFPPVMVKLLQALAQPEPDFSVIAELLAMDPVLAATIL
ELVNSPYYGQRNPVSDMQRAVVVLGSREILKIALSIAYQQRVTGALHRKPTELFPDWRMA
LWSAIAAEKLSAQLAPGDEALAYLAALLKDLGIFIRQCTRSSDPVLARRRYLTEYSRAHA
TSEQVHWGKEHQELSAELFSTWNMPQRFVDAVRHHHAPTLNGLDPFTLCVALATRWAELL
QTGQGDHAELIRHEMLMAGLLQLDGPGMEALRADCATRFRVLLSSLGIEDAPLSDRLYTQ
TLEDIQRFHFLSTELQRAASYEEAVKMTGRQLHWLWNMKKWEVALRDPSVNRYVLFRPVP
EQGVQPVASSAEVDALPWSRGGVRLPLAAEGDVYGSMNVPRSKTRLQEEGSLAVYARFLS
KGLEIFYTEQSGLRSKARLLDSLPNMVAQVDATGIIREANTAFLALAGQDSDPRGHALSD
VLRNAYGIETESVWRQITAETQNNAANKIFTYCTTQGAARTCALLSIFRNLPEQGAFLVR
IEDITQVSALEAEVLEQNDFLSSLMEAMQEVVFTVDATGRVLWTSSDMLLQAGAMLFDIA
AATTPGAAWGADHLPVQRQADTAEQQTAHPQEKQTPVPVEVAIKLPDGSSALYELSVSPL
KTRAETARWIIVGRDLTSIRRMEEKMRMQAVFDGLTGLFNHTHFHMLLDREIARCHRTRH
PLALIFLDLDGFKAINDTQGHREGDRILRQVSNALRSCIRKGTDFACRYGGDEFTVIVTE
FKEDALPAMSARILDAIESGTSGAVSASVGVALLQSQDSAESLVQRADTASYAAKKAGGR
QVAQAPLHPGSA
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcaagaagcagctgaccgcagtaagaccatggagtggtactccgagtgtctt
cagctcacgtttccccctgtgatggtcaaactgctgcaggcgcttgcccagccggagccc
gatttttctgtcatcgccgagctgctggccatggacccggttcttgcggccaccattctg
gaactggtcaactctccctactacgggcagcgcaatcccgtgtccgacatgcagcgggcc
gtagtggtactcggctcgcgggaaattctcaaaatagccctgtccatagcctaccagcag
cgcgtgaccggcgcactgcaccgcaaaccaaccgaactttttcccgactggcgcatggca
ctgtggagcgccattgccgcagaaaaactgtcggcccagctggcacccggcgacgaggct
ctggcctatcttgccgcactgctcaaagatctgggaatttttatcagacagtgcacccgc
agttcagaccccgtgcttgcccgccgccgttatctgacggaatattcccgcgcccacgcc
acatccgaacaggtccactggggcaaagagcatcaggagctttccgcagaactgttcagc
acatggaacatgccgcaacgctttgtcgacgcggtgcgccaccatcatgccccgacgctt
aacgggctggaccccttcacgttgtgcgtcgcgcttgccacccgctgggccgaactgctg
cagaccggacagggcgatcatgcggaactcatccgccatgaaatgctgatggccgggctg
ctgcagcttgacgggccgggtatggaagcgctgcgcgccgactgtgccacccgcttccgc
gttctgctcagctctctgggcatagaagacgccccgctttccgacagactctacacccag
acgcttgaagacattcagcgctttcattttctgagcacagaactgcagcgcgccgcctcg
tacgaagaagccgtcaaaatgaccggcagacagctgcactggctgtggaacatgaaaaaa
tgggaagtggctctgcgcgatccttccgtaaacagatatgtgcttttccgtcctgtgccc
gaacagggtgtgcagcccgttgccagcagtgccgaggttgacgccctgccgtggagcaga
ggcggtgtgcgcctgccgctggctgccgagggtgacgtgtacggcagcatgaacgtgccg
cgcagcaaaaccagactgcaggaagaaggcagcctggccgtatacgccagatttctctca
aaagggctggaaatattctatacggaacagagcggactgcgcagtaaagcccgtctgctt
gattcgctgcccaacatggtggcgcaggtggacgccacaggcatcatacgcgaagccaac
acggcctttcttgcacttgccgggcaggacagcgacccgcgcgggcatgctttaagcgac
gtgctgcgcaatgcatacggcattgagaccgaatcagtatggcggcagatcacggcggaa
acacaaaacaatgccgcaaacaaaatttttacatactgcaccacgcagggagcagcccgt
acctgcgctctgctcagcatcttccgcaacctgcctgagcagggggcatttctggtacgt
atcgaagacataacacaggtttccgcactggaagccgaagtgctggaacaaaatgacttt
ctgagcagcctcatggaggccatgcaggaggtggtgttcaccgtcgacgccaccggcaga
gtgctgtggaccagctcggacatgctgctgcaggccggtgccatgctgtttgacatcgcc
gccgccacaacgcccggtgccgcgtggggggccgatcatctgcctgtgcagcggcaggcg
gacactgcggaacagcagacggcacacccgcaggaaaaacagacgcccgtaccggtggaa
gtcgccataaaactgcccgacggcagcagcgcactgtacgagctttcagtctcgccgctc
aaaacgcgggcggaaacagcgcgctggatcatcgtggggcgcgatctgaccagcatccgg
cgcatggaagaaaaaatgcgcatgcaggcagtgtttgacggcctcacagggcttttcaat
catacgcattttcacatgctgctcgacagagaaatagcccgctgccatcgcacacggcat
cctctggcacttatcttccttgatctggacgggttcaaagccatcaacgacacgcaaggg
caccgcgaaggcgacagaatactgcgtcaggtttccaacgccctgcgctcctgcatacgc
aaaggaactgattttgcctgccgctacggcggcgacgaatttaccgtcatcgtgacggaa
ttcaaagaagacgcgctacccgccatgtccgcccgcatactggacgccattgaatcgggc
acatcaggtgctgtaagcgccagtgtgggggttgcccttctgcaatcgcaggattctgcg
gaaagtcttgtccagcgggccgacaccgcaagctacgccgcaaaaaaagccggaggacgg
caggttgctcaagcccccctgcatcccggttccgcatga

DBGET integrated database retrieval system