KEGG   Deferribacter desulfuricans: DEFDS_0078Help
Entry
DEFDS_0078        CDS       T01188                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
ddf  Deferribacter desulfuricans
Brite
Enzymes [BR:ddf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     DEFDS_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Cyc-maltodext_C SNF2_N
Motif
Other DBs
NCBI-ProteinID: BAI79590
UniProt: D3PAG7
Position
complement(86477..88318)
Genome map
AA seq 613 aa AA seqDB search
MSKKFDPSKFHLLEADYSKPLLEIPIELKKKIINRLTILYDSFKAKKWYPEVERIMKVYY
AHKTDTMKEWEKRFNPKDRFTEKDVVLITYGDIIKNRYKKPIKVLSKFVKKYLKNVINTI
HLLPFYPYSSDRGFSVIDFEQVDPRIGSWEDIINLKKDFKLMFDGVFNHISSKSRWFQEF
LNGNPDYQNYFIVLSTKEMISEDHLKLILRPRTTPLFTEFDTINGKKLVWTTFSPDQIDL
NYRNPKVLIRMLDILLYYVRRGADIIRLDAVTYLWEELGTECAHLKQTHETIKLFRDILS
FVAPHVAIITETNVPHEQNIKYFGNGYDEAHMVYNFALPPLVLYTYYTKDSTKLTNWAKT
ITKVSDEATYFNFLDSHDGIGLLPAKGILDDKDIEMMVLKTLEHGGFISYRTDKDGNESP
YELNITWYSALNNEDEPEDEMIKLKRFISSRVIALSFMGVPAIYIHSLFASKNDAEAVLN
EKQTRSINRKVLSEKSLNEILRNESSHSHKALKMLINVISKRVKEKAFHPNAQQKVINID
KRVFALLREYEDSKVLVIVNITDAEFDLNINLKHYFKNNCDLVNLITEQKISYKDSNLLI
KLKPYDYLWLKGY
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaattcgatccttccaagtttcatcttttggaagcagattacagcaaacct
ctcttagaaattcccatagagcttaagaaaaaaattatcaatagactaactattctttat
gactccttcaaagccaaaaaatggtatccagaagtagaacgaataatgaaagtttattat
gcccataaaacagatacaatgaaggagtgggaaaaacggtttaacccaaaagatcgtttt
acagaaaaagatgtagtgctgataacttatggggacataataaaaaatagatacaaaaaa
ccgataaaagtattgtccaagtttgtaaaaaaatatctaaaaaatgtaattaatacaata
caccttctccctttttacccttattcatctgatagaggtttttcagttatagattttgaa
caggttgacccaagaataggtagttgggaagatattattaatcttaaaaaagatttcaag
cttatgttcgatggcgtttttaatcacatttcatcaaaaagtaggtggtttcaggagttc
ttaaatggcaatcctgactatcaaaattattttattgtgttgtcaacaaaagagatgatt
tctgaagatcatttaaaactaatattgaggccaaggacgaccccactttttacagaattt
gatacaataaatggtaaaaaactggtttggactacttttagtccagatcaaattgatcta
aattacagaaatccaaaggttttaattagaatgcttgatattttactctactacgttaga
agaggcgctgatatcataaggcttgatgcggtaacatatctgtgggaagaactgggtaca
gaatgtgcccatcttaaacaaacccatgaaacaataaaactttttagagatattttaagt
tttgtagcaccacacgtggccataattactgaaacaaatgtccctcatgaacaaaatatt
aaatattttggcaatggatatgacgaagcacatatggtatataattttgctttgccacca
ctcgttttatatacatactacacaaaagattcgacgaaacttacaaactgggcaaaaact
atcacaaaagtttctgacgaagcaacttattttaattttttagattcccatgacggaata
gggcttttgcctgctaaagggatattggatgataaagatatagaaatgatggttttaaaa
acccttgagcatggaggctttatctcatacaggactgacaaagacgggaacgagtcccct
tatgaactgaatattacatggtacagcgcattaaacaacgaagatgagccagaagatgaa
atgattaaactaaaaagatttatctcatctagagtaattgcactatcatttatgggggtt
cctgcaatatatatacacagtttattcgcatcaaaaaatgatgccgaagcagttttaaat
gaaaagcaaacaagaagtataaacaggaaagtattaagtgaaaaatcgttaaatgaaatt
ttaagaaatgaaagtagccatagtcataaggcattgaaaatgcttattaatgttatatct
aaaagagttaaagaaaaagcattccatccaaacgcacagcaaaaagttataaacatagat
aaaagagtttttgcattactaagagaatacgaagactctaaagttttagtcatagtaaac
atcacagatgctgaatttgacctaaatattaatttaaaacattattttaaaaacaactgc
gatctcgtaaatttgattactgagcaaaagataagctataaagattctaatttattaata
aaactaaaaccttacgattatttatggttaaagggatattag

DBGET integrated database retrieval system