KEGG   Deferribacter desulfuricans: DEFDS_0441Help
Entry
DEFDS_0441        CDS       T01188                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ddf  Deferribacter desulfuricans
Pathway
ddf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddf01100  Metabolic pathways
ddf01110  Biosynthesis of secondary metabolites
ddf01130  Biosynthesis of antibiotics
ddf01230  Biosynthesis of amino acids
Module
ddf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DEFDS_0441 (trpC)
Enzymes [BR:ddf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DEFDS_0441 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE NMO
Motif
Other DBs
NCBI-ProteinID: BAI79935
UniProt: D3PBG2
Position
425990..426727
Genome map
AA seq 245 aa AA seqDB search
MFLEEVYLKKIEEVKGLKVEGVRNKRIIPFGINLPEKRVIAEVKQASPSLGLIKNVDVCL
QAKRYEKGGAAAISVLTDKYYFNGSFEFLNRISKEVSLPILCKDFIIDKKQVDMAYMNGA
DVILLIVSLLDDKSLFNLYEYAKSLGLEVLVEIHEFEEFKRVENMGIKFLGVNSRNLKTL
KIDKSYALNVLKNIDGEFVKVAESGIETIDDVMMFRNVGAEMFLIGTTLMKSESPEELIR
KFNQV
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaagaggtttatctgaaaaaaattgaagaggttaaaggtctaaaagtagaa
ggtgttagaaataaaaggattataccttttggtattaaccttccagagaagagggttata
gctgaagttaagcaggcttctccatctttaggccttataaaaaatgtagatgtttgttta
caggcaaaaagatatgaaaaaggtggtgcagcagctataagtgttcttactgataaatat
tactttaatggaagttttgaatttttaaacagaattagcaaggaagtgagccttcccata
ttgtgtaaagattttatcatcgataaaaaacaggtggatatggcctatatgaatggtgct
gatgttatccttttgatagttagtcttcttgatgataaatcgttgtttaatctttatgaa
tacgcaaaaagccttggattagaagtattagtggaaattcatgaatttgaagaatttaag
agagttgaaaatatgggtattaaatttttaggggtaaatagcagaaatttgaaaacttta
aaaattgataaaagctatgccttaaatgtgttaaaaaatatagatggtgaatttgtaaag
gtagctgaaagtggaattgagactattgatgatgtaatgatgtttagaaatgtaggagct
gagatgtttttaatagggactacccttatgaagtcagaaagtcctgaagaattgatcagg
aaatttaatcaggtgtaa

DBGET integrated database retrieval system