KEGG   Deferribacter desulfuricans: DEFDS_1337Help
Entry
DEFDS_1337        CDS       T01188                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ddf  Deferribacter desulfuricans
Pathway
ddf00010  Glycolysis / Gluconeogenesis
ddf00052  Galactose metabolism
ddf00500  Starch and sucrose metabolism
ddf00520  Amino sugar and nucleotide sugar metabolism
ddf00521  Streptomycin biosynthesis
ddf01100  Metabolic pathways
ddf01110  Biosynthesis of secondary metabolites
ddf01120  Microbial metabolism in diverse environments
ddf01130  Biosynthesis of antibiotics
ddf01200  Carbon metabolism
Module
ddf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEFDS_1337 (glcK)
   00052 Galactose metabolism
    DEFDS_1337 (glcK)
   00500 Starch and sucrose metabolism
    DEFDS_1337 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    DEFDS_1337 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DEFDS_1337 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DEFDS_1337 (glcK)
Enzymes [BR:ddf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DEFDS_1337 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Pan_kinase
Motif
Other DBs
NCBI-ProteinID: BAI80800
UniProt: D3PDX7
Position
complement(1347060..1347926)
Genome map
AA seq 288 aa AA seqDB search
MNVYVFDIGGTNIKYAYFNNETIEFKDTVKTPSSYDELLSLIKHKIQKPYDKVVIGLPAI
LDYEKNCPIYAPNLTYLTNKNVVSHLNIKNVYLENDANLAAFGEYKKCHHDVKNMLMVTL
GTGVGGGLILNGRIVKSKYSLAEIGHIVVVDNGWKCSCGNRGCLEAYCGKNGIMNIYKSL
SNNKEEIDSVNRIYQLAIQKKLIAKLTFKQFAHYLAIGVASFVNSIYVEKVVLGGGVSHY
SDMFFKDFIKFFNEKLYPPYKKDVIIHLSRLKNDAALYGGYFYAKDIL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttatgtttttgatataggtgggacaaatattaagtatgcctactttaataat
gaaacgatagaatttaaagatactgttaaaacgccaagtagttatgatgaattattgagt
ttgataaagcataaaattcaaaagccttacgacaaagtggtaattggcctaccagctatc
ttagattatgagaaaaattgcccaatttatgctccaaatttaacttatttgacaaacaaa
aatgttgtcagccatttgaatataaaaaatgtttatttggaaaatgatgccaatttagca
gcctttggagaatataaaaaatgccatcatgatgtaaaaaatatgttaatggttactttg
ggaacaggtgtgggtggtggtttaatattaaatggtagaattgtaaaatcaaagtattct
ttagctgaaattggtcatattgtagtagttgataatggttggaaatgttcttgtggtaat
agaggctgtttagaagcttattgcggtaaaaatggtataatgaatatttataaatcttta
tcaaataataaagaagagattgattctgttaataggatatatcagttggcaattcaaaaa
aagttaatagcaaaattgacttttaaacagtttgcgcattatttggccattggtgtggct
tcatttgtaaactctatatatgtggaaaaggtagttttgggtggtggcgtttcacattat
tctgatatgttttttaaagattttattaaattttttaatgaaaaattgtatcctccatac
aaaaaagatgttataatacatttatcaagattaaaaaatgatgctgctctgtatggaggt
tacttttatgcgaaggatattttatag

DBGET integrated database retrieval system