KEGG   Deferribacter desulfuricans: DEFDS_1383Help
Entry
DEFDS_1383        CDS       T01188                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ddf  Deferribacter desulfuricans
Pathway
ddf00330  Arginine and proline metabolism
ddf00332  Carbapenem biosynthesis
ddf01100  Metabolic pathways
ddf01130  Biosynthesis of antibiotics
ddf01230  Biosynthesis of amino acids
Module
ddf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ddf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DEFDS_1383 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    DEFDS_1383 (proB)
Enzymes [BR:ddf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     DEFDS_1383 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Ku
Motif
Other DBs
NCBI-ProteinID: BAI80844
UniProt: D3PE21
Position
complement(1393600..1394742)
Genome map
AA seq 380 aa AA seqDB search
MRKLPDIKTLVIKIGSNLLTNNSRYIDKEYIRTLAKTIHKIKKDIKNILIVSSGAIAAGM
QQLGIGTKPKDIALRQACAAIGQPKLIQIYEDAFDEYNIKVAQILITKDDFANRRRYLNA
KYTIRELFKHSVVPIVNENDTVVVEELKFVDSFGDNDNLSALIAGLIGAELLLILSDVDG
FFSKDPTKHKDAVLINEIKYFDSKLLSMAGDSISNVGTGGMKSKILAAKKALNAGCYVGI
INGKDPDNIVKFLNGEEIGTFFSHLEDPLKKRKLWIAYATIPKGEIVVDNGARNALINKY
TSLLPSGIVDVKGRFSVGDIVKIVDINGIELGRGKVRYNHQEIEKIKGKKTTEIMKILGY
KFSDEVIHRDDFVLSDFLEG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattacccgacattaaaaccttagtcataaaaatcggaagtaacctcttaaca
aacaacagtagatatatcgataaagaatatattagaactttagccaaaactattcataaa
atcaaaaaagatattaaaaatattttaatagtaagttctggagcaatagctgctgggatg
cagcagttgggtattggaacgaaaccgaaagatatagctttaaggcaagcctgtgccgct
attggccaaccaaagcttattcaaatttatgaagatgcctttgatgagtataatataaaa
gtagcacaaattttgataacgaaagatgattttgccaatagaagaagatatctaaatgct
aaatacaccataagagagttatttaagcactctgtggtgccaatcgttaatgaaaatgac
actgtagtagttgaagagctgaaatttgttgatagttttggcgataatgataatctttct
gctctgatagcagggcttattggagcagagttgttgttgattttatcagatgttgatgga
tttttttcaaaagatcctacaaaacacaaagatgctgtcttaattaacgaaattaaatat
tttgatagtaaactgttgagcatggctggagattcaatttcaaatgttggtactggtgga
atgaagtccaaaatattagctgcaaagaaggcacttaatgcaggttgttatgtggggata
ataaatggtaaggatcctgataatattgttaagtttttaaatggtgaagaaattgggaca
tttttctcgcatcttgaagatcctttgaaaaaaaggaagttatggattgcatatgccaca
atccctaaaggggaaattgtggttgataatggagctagaaatgctttaattaataaatac
acatccttgctaccaagtggtattgttgatgttaaaggtcgatttagtgttggagatatt
gtgaaaattgttgatattaatgggattgagttaggacgtggtaaggttcgttataatcat
caggaaattgaaaagattaagggtaaaaagactacagaaattatgaaaattttaggatat
aaatttagtgatgaggtaatacatagagatgattttgttttatcagattttttggagggg
taa

DBGET integrated database retrieval system