KEGG   Deferribacter desulfuricans: DEFDS_1875Help
Entry
DEFDS_1875        CDS       T01188                                 

Gene name
pdxA
Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
ddf  Deferribacter desulfuricans
Brite
KEGG Orthology (KO) [BR:ddf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DEFDS_1875 (pdxA)
Enzymes [BR:ddf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     DEFDS_1875 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     DEFDS_1875 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA NSP11
Motif
Other DBs
NCBI-ProteinID: BAI81329
UniProt: D3P9D9
Position
complement(1898751..1899743)
Genome map
AA seq 330 aa AA seqDB search
MTSMEKIKIAVTIGDPAGVGPEICCKMIRDYCNKKPDDYELFVVGYKNIIKNTFQNVLKD
DFDKYNCVIVEPDEKVNLESIRYGVVNKECGKASMLFVEKATKMVLNGQADALVTSPINK
QAINLAGYDFPGHTEYLGYLTNTYDFSMMLVGDKIKVVLVTTHLAIKDIADRIDKKAVKK
AILNANSAGRFFGIQKPRIAVCGLNPHAGDGGVLGDEELKIITPVINELKSENIDVHGPF
PADSLFPKVLMGEFDFVVCIYHDQGLIPVKMESFGAAVNVTLNLPIIRTSVDHGTAYDIA
GKNLANYGSLQRAIEVAKDMVKNVKLNQSL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ataacaagtatggaaaagattaagattgcagttacgattggagatcctgcaggggttggt
ccagaaatttgttgtaaaatgatacgtgattactgcaataaaaagcctgacgattatgaa
ctgtttgtggttggatataaaaatatcattaagaatacttttcaaaatgtacttaaagat
gattttgataaatataattgtgtgattgtagagcctgatgagaaagtaaacttagaaagt
atccgttatggcgttgttaataaggaatgtggcaaagcttctatgttatttgtagaaaaa
gcaactaagatggtattaaatgggcaagcagatgctctagtaacatcgcctataaataag
caggctataaatttagctggatatgattttcctggtcatactgaatatctaggttattta
acaaatacatatgattttagtatgatgcttgtgggggataaaataaaagtagttcttgta
actactcatttagcaataaaggatatagcagatagaattgataaaaaagctgttaaaaaa
gcaattttaaatgcaaatagcgcagggcgtttttttggaattcaaaaacccagaattgca
gtttgtggattaaaccctcatgctggagatgggggtgtgcttggggatgaagagcttaaa
ataataacccctgttataaatgaattaaaaagtgaaaatatagatgtacatggcccattt
cctgctgattcactattcccaaaggtattgatgggtgaatttgattttgttgtttgtata
tatcatgatcaagggttaattcctgttaaaatggaaagttttggtgcagcagtcaacgtt
actcttaatttgccaataattaggacttctgtcgatcatggcacagcttatgatattgct
ggtaaaaatttagcaaattatggaagtttacaaagggcaatagaagttgctaaggatatg
gtaaaaaatgttaaacttaatcaaagcttataa

DBGET integrated database retrieval system