KEGG   Desulfitobacterium dehalogenans: Desde_0730Help
Entry
Desde_0730        CDS       T02146                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh00260  Glycine, serine and threonine metabolism
ddh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddh01100  Metabolic pathways
ddh01110  Biosynthesis of secondary metabolites
ddh01130  Biosynthesis of antibiotics
ddh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desde_0730
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desde_0730
Enzymes [BR:ddh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desde_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFL99177
UniProt: I4A5E3
Position
complement(758474..759841)
Genome map
AA seq 455 aa AA seqDB search
MTKVPYKIYLSEEEMPKNWYNLKAVMKELPPPMLHPGTLKPCTAEDLRPVFCDELIEQEL
NTKDLTIEIPEGIRDFYKMYRPSPLVRAYCLEKLLDTPAEIYYKFEGTNTSGSHKLNSAA
AQVYYAKKQGLTSLTTETGAGQWGTALSMACAYYQIDLTVYMVKISSEQKPYRKAVIETY
GGKVIPSPSDTTEIGKKILAENPGTGGSLGCAISEAIEMAVRSENCRYVLGSVLDHVVLH
QTVIGEETKIACEKYGIQPDIIIGCVGGGSNYAGLIAPFLGDKLQGKNNINFIGVEPASC
PSLTRGKYAYDFGDTGKTTPLLKMYTLGSGFIPSPNHAGGLRYHGMSSIVSKLYHDGLME
ARAVEQSKIFDAATLFARSEGILPAPESSHALRAAMDEALKCKETGEKKTILFGLSGTGY
FDLAAYMSYNAGTMTDFIPTDEDLEKSFATLPKVE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtaccttacaaaatctatctttctgaggaggaaatgccgaaaaactggtac
aacctgaaggctgtgatgaaagagcttccccctcctatgcttcacccagggaccctgaaa
ccctgcactgccgaagacctgcgacctgtattttgtgacgagttaattgagcaggaatta
aacactaaagacctcactattgagatccctgaaggtattcgggacttctacaagatgtac
cgaccctctcctctggtccgagcctattgcctggagaagttgctggatactcccgcagag
atctactataaatttgagggaaccaatacctccggctcccacaagctcaactccgctgcc
gctcaagtctactatgctaaaaaacagggcttaacctccctcaccacagagaccggcgcc
gggcaatggggtacggctctatccatggcctgtgcctattaccaaattgatctcaccgtc
tatatggtgaagatctcctctgagcagaagccttatcgaaaggctgtgattgagacctat
ggcggcaaggtcatcccctctccttctgacaccacagaaatcggcaaaaagatcctcgcc
gaaaatcccggtaccggcggctccctaggatgtgctatctccgaagccattgaaatggct
gtaaggtctgagaattgccgctatgtcttgggtagtgtccttgaccatgtggttctccac
cagacagtgattggtgaagagacaaagattgcctgcgagaagtacggtatccagcctgat
atcatcatcggttgtgtagggggcggttcaaactacgcgggtctgattgcccccttcctc
ggggataaactccaaggaaaaaacaatattaactttatcggcgtagaacctgcctcttgt
ccatctttgacccgtggcaaatatgcctatgattttggcgacacaggaaaaactacccca
ctgctgaaaatgtacaccctaggttcaggatttatcccttctcccaaccatgccggtggt
cttcgctaccacggcatgagcagcatcgtatctaagctctatcatgatggtcttatggaa
gctcgggctgttgagcagtctaagatcttcgatgccgctactctctttgcccgcagtgaa
ggaattctccccgctcctgaatcttcccacgcactgcgagccgctatggatgaagccctc
aaatgtaaggaaaccggcgagaagaaaaccatcctctttggactctcaggtaccggatac
ttcgatctggctgcatatatgagctataacgcaggcactatgaccgactttattcctacg
gatgaagatctggaaaagagtttcgctaccttgcctaaagttgagtag

DBGET integrated database retrieval system