KEGG   Desulfitobacterium dehalogenans: Desde_1062Help
Entry
Desde_1062        CDS       T02146                                 

Definition
(GenBank) helicase, putative, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desde_1062
Enzymes [BR:ddh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Desde_1062
DNA repair and recombination proteins [BR:ddh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Desde_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 UvrD_C AAA_11 HTH_38 DUF2075 UvrD-helicase AAA_28 AAA_22 PIF1 Helicase_RecD NTPase_1 AAA RsgA_GTPase T2SSE AAA_12 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AFL99494
UniProt: I4A6B0
Position
1077791..1080034
Genome map
AA seq 747 aa AA seqDB search
MATATAARMKKGKETVKPVATLAGKIISVRFHNPQNGYSVISIEPKDMVETGMVSCSAVG
NLAAVRVGDEYEFAGEWKEHPQYGRQFAFCKADVVLPKEKTGAATYLATLAYGVGFAKAK
RIVDRLGDDALNRIIEAPALLDQFHFLSPQQREEIQEGLLKNTRLAELAALICKEGVGIG
TATRIFNTYGQASVSIVKENPYVLADEVYGIGFKVADRIGMGLSIAPDSPYRVESAYMYA
LREAGNDGHVYLTPKDTIVALDGLLGKQSMVGVSNIKDAYAELEQRGLVCREGDAIYVAS
MLAEEKQLARDIVRLAQMDGKYLSTDTEQKLEEVTEAMQAEFGVIYAPEQKEAIKKSFYK
SLSVVTGGPGTGKTTVIKGIIEAYRKIARSNLIMLAAPTGRAAKRMTEATGCDASTIHRL
LKFNPMINGFEHDADNQLPAGLLIVDEYSMSDLHLAKCLFEAVPSDMLMVIVGDVDQLPS
VGPGKVLEDIIESRQVITTRLKFNYRQASGSRIALEASRVVEFGECRLYQDEKDWKTILE
DEPEKAVTRIKAEVRAALAQGLGIMDFQVLAPMKKGLVGVDNLNEVIREIVNPPDVLKPE
KKTGKDKFFRLGDKIMVIRNNYKLGVFNGDIGVIQGIDSSSIAVDFEGEMVTFSEDNIND
LTLAYASTIHKSQGSEFPLVIMIIMRSHYIMLQKNLFYTGFTRAKQRLVLVCQESAVKRC
LDNAEKKERHTLLRDRIIAYAGASQSA
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggccacggcaacagcagcgcgaatgaaaaaaggaaaagagacggttaagcctgtcgct
actctggccggaaaaatcatatctgtgcggtttcataatcctcaaaacggttactccgta
atctctatagagcctaaagacatggtggaaacgggtatggtctcctgcagtgccgtcggc
aatctggcggcggtcagggtaggggatgaatacgaattcgccggcgagtggaaagagcat
ccgcagtacgggcggcagttcgcattctgtaaggccgatgtggttctgcccaaggaaaag
accggggcagccacctatctggccaccctggcttatggggtagggtttgcaaaggcgaaa
cggattgtcgataggctaggggacgatgcccttaaccgaatcattgaggccccggcttta
ctggatcagttccactttctttctccccagcagcgggaagagattcaggaaggattgctt
aaaaacaccaggcttgcggagctggcagccctcatatgcaaagaaggtgtcggcattggc
acggcaacaagaattttcaacacctacggccaggccagtgtgtctatcgttaaagaaaat
ccctatgtgttggctgatgaggtgtacggcatcggcttcaaggtagccgacaggatcggg
atggggttgagcatcgctccggattcgccatatcgggtagaatcggcctatatgtacgct
ctccgggaagccggcaatgatggccatgtctatctgaccccaaaggataccatcgttgcc
ctggatgggttgctgggtaaacagtccatggtgggagtgagcaacatcaaagatgcttac
gctgagcttgagcagcgggggctggtttgccgggaaggagacgctatttatgtagcctcc
atgttggccgaggaaaagcagctggcccgagatattgtccggctggctcagatggacggg
aaatatttgtccacggataccgagcaaaagctggaggaagtcactgaagccatgcaggca
gaattcggcgttatctatgccccggagcagaaagaggccatcaagaagagcttttataaa
tcattgtcagtagtgacaggtggcccgggaaccgggaagacgactgtcattaaaggcatc
attgaggcttatcggaaaatagccagaagcaacctgattatgctagcggcaccgacgggc
cgggcggcgaagaggatgacggaggccaccggatgcgatgcctctaccatccaccgactg
ctcaaattcaaccctatgatcaatgggtttgagcacgatgcggataaccaacttcctgcc
ggtctgttgattgtggatgaatactccatgagtgacttacacctagctaagtgcctcttt
gaggcagtaccaagtgacatgttgatggtcatcgttggtgacgtggatcagctccccagc
gtcgggccgggaaaagtactggaggacattattgaatcccgtcaggtcatcacaacccgg
ctaaagttcaactaccggcaagcctccggtagccgcattgcccttgaggcatcccgggtg
gttgagttcggagaatgccgcctttaccaggatgaaaaggattggaagactatccttgaa
gatgagccggaaaaggctgtcacaagaatcaaggccgaagtaagggcggctctggcccag
gggttggggatcatggattttcaagtgctggcccccatgaaaaaggggcttgttggggta
gataacctgaatgaagtgattcgggaaattgtgaatccacccgacgtattgaagccggaa
aagaagactggtaaagataaattcttccgtcttggtgacaagatcatggtgatccgcaat
aactacaagctgggagtgtttaacggagatatcggggtgattcagggaattgattccagt
agtattgctgtcgactttgaaggggaaatggttacgtttagcgaggacaacatcaacgac
ctaaccctggcctatgcaagcacaatccacaaaagccaggggtcagagttccctctcgtg
atcatgattattatgcggagtcactacatcatgctgcagaaaaatctattttacactggc
tttacccgggctaagcagcgcttggtgctggtgtgccaggagagtgccgtgaagcggtgc
ctggacaatgccgagaaaaaagaacggcacacgctcttacgggataggatcatagcctat
gcaggcgccagccaatcagcttaa

DBGET integrated database retrieval system