KEGG   Desulfitobacterium dehalogenans: Desde_2308Help
Entry
Desde_2308        CDS       T02146                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh00071  Fatty acid degradation
ddh00280  Valine, leucine and isoleucine degradation
ddh00310  Lysine degradation
ddh00362  Benzoate degradation
ddh00380  Tryptophan metabolism
ddh00620  Pyruvate metabolism
ddh00630  Glyoxylate and dicarboxylate metabolism
ddh00640  Propanoate metabolism
ddh00650  Butanoate metabolism
ddh00720  Carbon fixation pathways in prokaryotes
ddh00900  Terpenoid backbone biosynthesis
ddh01100  Metabolic pathways
ddh01110  Biosynthesis of secondary metabolites
ddh01120  Microbial metabolism in diverse environments
ddh01130  Biosynthesis of antibiotics
ddh01200  Carbon metabolism
ddh01212  Fatty acid metabolism
ddh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ddh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desde_2308
   00630 Glyoxylate and dicarboxylate metabolism
    Desde_2308
   00640 Propanoate metabolism
    Desde_2308
   00650 Butanoate metabolism
    Desde_2308
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desde_2308
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Desde_2308
   00072 Synthesis and degradation of ketone bodies
    Desde_2308
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desde_2308
   00310 Lysine degradation
    Desde_2308
   00380 Tryptophan metabolism
    Desde_2308
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desde_2308
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desde_2308
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desde_2308
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddh04147]
    Desde_2308
Enzymes [BR:ddh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Desde_2308
Exosome [BR:ddh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desde_2308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFM00653
UniProt: I4A9L8
Position
complement(2325477..2326655)
Genome map
AA seq 392 aa AA seqDB search
MREVVIVSAVRTPLGSFGGTLENFTGAELGAIVIKEAIKRAGILPAQVEEVIMGNVLSAA
AGQNPARQAAIKAGIPQEVPAWTLNKVCGSGLKSVICGAQAILAGDADIIVAGGMECMSS
SAYALLKARKGYRMGNDSLVDTMITDGLTDAFHNIHMGLTAENIAEQFQISREDQDALAL
RSQNRAEAAIQSGLFDEEIVPVEIPQKRGEPLVFSQDEFPRFGTTADTLTKLRPAFKKEG
TVTAGNASGINDGAAAVVVMSKEKAEELGLAVLAKITSWASAGVDPLIMGTGPIPATRKA
LAKAGLTIADIDMVEANEAFAAQAAIVTQELGLDVEKTNVNGGSIALGHPIGASGTRVLV
TLLHELKRRDGHRGLATLCIGGGQGVSLIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtagtgattgtcagtgctgttcgtacaccccttggatcctttgggggaact
ttagagaactttacaggagccgaactgggagctatcgtgatcaaggaagcgatcaaacgg
gccggaatcctgcctgcacaagtagaagaagtcattatggggaatgtactcagtgctgcg
gcaggtcaaaaccctgccagacaagcagcaattaaagcaggaattcctcaagaagtgccc
gcctggaccctgaataaggtctgcggttccggacttaaatcggtaatctgtggggcgcag
gcgatcctggccggtgatgcggatattattgtcgccggcggcatggagtgcatgtcatca
tcagcctatgcccttcttaaagcaagaaaaggatatcgaatgggcaatgacagcctggtg
gataccatgatcacggatggtctaaccgatgctttccataatattcacatgggattgacc
gccgagaatatcgctgagcaattccagatttcccgggaggatcaggatgctttggcactg
cgcagtcaaaaccgtgctgaggccgctatccaatccggattattcgatgaagagattgtt
cctgtggaaatccctcaaaaaagaggggagcctctggtgttcagtcaggatgagttcccc
cgtttcggcactactgccgatactttaactaagctgaggcctgcctttaagaaagagggt
acggtaactgcgggcaacgcttcagggatcaatgacggagctgctgcagtggtcgtcatg
tccaaagagaaggctgaggaattgggattagcggtcctggccaaaatcacttcttgggct
tctgccggggtggatcctctgatcatggggaccggaccgatccctgcgacacgaaaagcc
ttggcaaaagccggattaaccattgccgatattgacatggtggaggccaatgaagccttt
gccgcccaagccgctatcgttacccaggagctgggattggatgtggaaaagactaatgtc
aatggcggctccatcgccttagggcaccccatcggtgcttccggcacccgcgtcttggtc
acccttcttcatgaattgaaacggcgggatggacatcgagggcttgcgactttatgcatc
ggcggaggtcagggagttagcctgattgtagagagatag

DBGET integrated database retrieval system