KEGG   Desulfitobacterium dehalogenans: Desde_2919Help
Entry
Desde_2919        CDS       T02146                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh00730  Thiamine metabolism
ddh00900  Terpenoid backbone biosynthesis
ddh01100  Metabolic pathways
ddh01110  Biosynthesis of secondary metabolites
ddh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ddh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Desde_2919
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desde_2919
Enzymes [BR:ddh01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     Desde_2919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C Transketolase_N TPP_enzyme_C E1_dh PFOR_II 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFM01222
UniProt: I4AB87
Position
complement(2928346..2930241)
Genome map
AA seq 631 aa AA seqDB search
MGILEEIDQPQDLKGLTYPELEQLAQEIRTEMIDVVSSNGGHLAPNLGVVELTLALHRVF
DSPKDKIIWDVGHQSYVHKLVTGRQKEFKSLRLYKGLSGFPKRCESPHDCFETGHSSTSI
SAAVGFAKARDLRKEKNQVVAVIGDGAMTGGMAFEALNHAGHTKTNMIVVLNDNEMAIAQ
NVGAMSSYLNRLRTDPRYDRSKDEIENLLKRIPGIGSKVAKAAEKAKDSLKYLLVPGLLF
EEMGFTYLGPINGHDQIALEQVLEQAKMVKEPVLVHVLTQKGKGYEPSEKNPSLFHGVGP
FNKVTGEVIKKPAPPTYTEVFGKTLCEIAETDLRIAAITAAMPGGTGLNLFAQKFPDRFF
DVGIAEQHAVTFSAALAFGGMKPVVSIYSTFYQRAYDQVLHDVCLPHANVVMAIDRAGVV
GDDGPTHHGVFDISFLRVIPNLVFMAPKDENELRHMLYTSLQLDGPVALRYPRSVGQGVE
LTEELKELPVGKAEVIQEGKDITLIGIGPMVYTCMAAAVELRHRGVEATVINLRYINPLD
RETILRYARMTKRLITVEDHMLAGGMGSAIIEVLADEGLADVVVERLGYDDYVDQGAISL
LHQGYGLSVVGILKAAERLKVLQRIEGRSSV
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
gtggggattctcgaagaaattgaccagccccaggatctaaaagggctgacttatcccgaa
ctagaacagcttgcccaggaaatccgcacagaaatgattgatgtggtctcctccaatgga
gggcatttggctcccaatcttggagtcgtagaattaacccttgccttgcatcgcgttttt
gacagcccgaaggataaaatcatctgggatgtgggccatcagagctatgttcataaatta
gtcacaggtagacaaaaggaatttaaaagcttacgactttataaaggcctatccggtttc
cccaaacgctgtgaaagccctcatgattgctttgaaacaggtcattccagcacctccatt
tcggcagctgtcggctttgctaaagcaagagatctgcgcaaagagaagaatcaagtggtt
gctgtcatcggtgatggagctatgaccgggggaatggcttttgaagcattgaaccacgct
ggtcataccaaaaccaatatgattgtggtcctcaatgataatgaaatggctatcgcccaa
aatgtaggggctatgtcctcttatcttaaccggttgcgtacagacccacgctatgatcgc
agcaaagatgagatcgaaaatctcctcaagaggattccgggaattggttccaaggtggcc
aaagccgcggagaaagccaaagacagcttgaagtatctgctggtgccgggactattattt
gaagaaatgggatttacctatcttggccctattaacggtcatgatcaaattgctttggaa
caggttctcgaacaagccaaaatggtgaaggaacctgtacttgtccatgttttgactcaa
aagggaaagggctatgagccttcagaaaaaaacccctccctcttccatggggtgggacct
ttcaataaggtgacaggggaagtaatcaaaaagccggccccacctacctataccgaagtc
tttgggaagaccctgtgcgagattgctgaaacagatctgcggattgcagcgattactgcg
gccatgcctggtggcacaggccttaatctcttcgctcaaaaatttcccgaccgtttcttt
gatgtcggaatcgcggaacagcatgcggtgaccttttcagcggccttggcctttgggggg
atgaagcccgtggtgtccatctattctaccttttatcaacgtgcttatgaccaggttctc
catgatgtctgcttgccccatgccaatgtggtcatggctattgatcgtgccggcgtggtc
ggggatgatggaccgacccatcacggagtttttgatatttcctttttaagggtaataccg
aatttggtctttatggcgccgaaggatgagaatgagctgcgccatatgctttacacttct
ttgcaactggacggacctgtcgctttacgttatccccgttctgtgggtcaaggggtggaa
ttgactgaagagctcaaggaacttcccgtgggtaaagccgaggtcattcaagaaggcaag
gatattaccctgattgggattggtcctatggtgtatacctgcatggccgcggcagtggag
ctccgtcaccgcggagtggaagcaaccgtcattaatctgcgttatatcaatcctttggat
cgagagacgattcttcgctatgcccggatgaccaagcgcctcattacagtcgaggaccat
atgctggcagggggcatgggaagcgccattatagaagttctggctgatgagggattggcc
gatgtggtcgtcgaacgtttaggttatgacgattatgtagatcaaggagccatttctttg
ctgcatcaagggtatggtttatctgttgttggtatactaaaggcagcggagcgtttaaag
gttttacagcggattgagggtagaagcagtgtctaa

DBGET integrated database retrieval system