KEGG   Desulfitobacterium dehalogenans: Desde_3345Help
Entry
Desde_3345        CDS       T02146                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh00230  Purine metabolism
ddh01100  Metabolic pathways
Module
ddh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Desde_3345
Enzymes [BR:ddh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Desde_3345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 AAA_22 RNA_helicase ADK AAA_17 TsaE ABC_tran RsgA_GTPase MMR_HSR1 AAA_28 Thymidylate_kin Cytidylate_kin AAA_5 Rad17 NTPase_1 T2SSE AAA_29 Zeta_toxin cobW PduV-EutP APS_kinase AAA
Motif
Other DBs
NCBI-ProteinID: AFM01633
UniProt: I4ACE8
Position
complement(3336615..3337217)
Genome map
AA seq 200 aa AA seqDB search
MEQNHGLLIVLSGPSGAGKGTLCQELLRQIPQVKYSVSATTRQPRPGEVDGLHYYFRSRE
EFQTMIEQDQLLEWAEFCGNYYGTPQFAVEQAIQAGNDVILEIEIQGALQVKKRFPQGVF
IFVVPPSMDELSQRIHKRGTESEEVIQKRLQTAARELEYVSEYDYVVVNDEIPLAVDKLK
SILLAEKCRVKRKPYVFQGV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtggaacagaatcatggattattgattgttctatccggtccttccggggcaggaaaagga
accctttgccaggagctgttaagacagatacctcaggtgaagtattccgtgtcggctacg
acacgccagcctcgtcctggtgaagtggatggattgcattattattttcgaagccgggaa
gaatttcaaaccatgatcgaacaggatcaacttttggaatgggctgagttttgcggtaat
tattatggaaccccgcaattcgccgtggaacaagccattcaagctgggaatgatgtcatt
ctggagattgaaattcaaggggccttacaagttaagaaacgctttccacaaggggtgttt
attttcgttgtgccgccgtccatggatgaactttctcagcgcatccataaacgcggtacc
gaatccgaggaagttatccaaaaacgactgcagactgctgctcgggaactggaatatgtg
agcgagtatgattatgtggtcgtgaatgatgagattcctctggcagtagataaactgaag
agcattcttcttgctgagaaatgtcgtgtcaaaagaaaaccttatgtatttcagggggtg
taa

DBGET integrated database retrieval system