KEGG   Desulfitobacterium dehalogenans: Desde_4009Help
Entry
Desde_4009        CDS       T02146                                 

Definition
(GenBank) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh00561  Glycerolipid metabolism
ddh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Desde_4009
Enzymes [BR:ddh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Desde_4009
Exosome [BR:ddh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desde_4009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFM02271
UniProt: I4AE86
Position
complement(4077116..4078612)
Genome map
AA seq 498 aa AA seqDB search
MKKYILALDQGTTSCRAILFDRESHIVGVAQKEFTQIYPQPGWVEHDPEEVWSTQYGVIA
ELLARYQVNIEEIAGIGITNQRETTVVWDKHTGKPVANAIVWQCRRTAPLCDELKMKGRE
PLFKKKTGLVLDAYFSGTKIRWILDQVPGAQEKAEKGELLFGTMDSWLVWNLTKGRIHVT
DYSNASRTLLYNIKTLEWDTELLRILNIPLAMLPEVKPSSTIYGETAPEGFFGHSIPIAG
IAGDQQAALFGQACFEPGMAKNTYGTGCFMLLNTGEELYESQHGLISTIAWGLDEKVVYA
LEGSVFMAGAVIQWLRDELKLIETAGDSEYFAGKVADNGGVYLVPAFTGLGAPYWDMEAR
GAILGLTRGSNKNHVIRAALESMAYQTRDILEAMEADSQLPLQLLKVDGGAVVNNLLMQF
QADILGVEVERPYCIETTALGAAYLAGLATGFWSNKEELKGKANIERSFKPQMEAGLKEK
YYQGWKKAVTHTMGSLDS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatacattcttgccttagatcaggggacaaccagttgtcgagcgatccttttt
gatcgggaaagccatatcgtaggagtggcacaaaaagaatttacgcaaatataccctcaa
cccggctgggtggagcatgatccggaagaagtgtggagcacccaatatggggtcattgcc
gagcttctggcccgttatcaagtaaatattgaagagattgccggaatcgggattaccaat
cagcgtgaaaccactgtagtttgggataagcacacggggaagcctgtggccaatgctatt
gtctggcaatgtcgaagaacagctcccctctgtgatgaactaaagatgaaaggacgagag
cctttatttaagaaaaaaacaggcttggtcttagacgcctatttttctggaactaaaatc
cgctggattctcgaccaggtgccgggcgctcaggaaaaagccgaaaaaggagagctgctc
tttggaaccatggattcctggttggtttggaatctgaccaagggccgtattcatgttacg
gattactccaatgcctcccgcaccctcctctataatattaagactttggaatgggacaca
gagctcctccgcatactcaatattcctttagccatgctccctgaggtaaagccctccagc
actatctacggggaaacagctcccgaaggttttttcgggcattctattcccatagccgga
attgcaggggatcagcaggccgccctcttcggtcaggcttgctttgaaccggggatggcc
aaaaacacctatggcaccggctgctttatgcttcttaatacaggggaagaactctatgaa
tctcagcacggtctcatcagtaccatcgcctggggacttgatgaaaaagtagtttatgcc
ctggaaggcagtgtctttatggccggagcagtgattcagtggctgcgggatgaattaaag
ctgatcgaaaccgcaggggattcggaatatttcgcagggaaggttgccgataacggcggg
gtctatctggtgcctgcctttacaggactgggtgcaccttactgggatatggaggctcgt
ggggctattttgggattaacccggggcagcaataagaaccatgtcattcgtgcagcttta
gagtctatggcttatcagaccagagatatcctggaggctatggaggcggactcccaattg
cctctccaacttctgaaagtcgatgggggagcggtggtcaataacctcttgatgcagttt
caggctgatatcctgggagtagaagtggaacgtccttattgtattgaaaccacagcctta
ggcgcagcctatctggccgggctggctacagggttttggagcaataaagaggagttaaaa
gggaaggcgaacatcgaacgctcctttaaacctcagatggaagcggggcttaaggaaaag
tactatcaaggctggaagaaggccgtcacccacacgatgggctccctcgactcatag

DBGET integrated database retrieval system