KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0267402Help
Entry
DDB_G0267402      CDS       T00245                                 

Gene name
H3a
Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0267402 (H3a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0267402 (H3a)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    DDB_G0267402 (H3a)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0267402 (H3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S PAF
Motif
Other DBs
NCBI-GeneID: 8616389
NCBI-ProteinID: XP_647577
dictyBase: DDB_G0267402
UniProt: O15819
Position
1
AA seq 139 aa AA seqDB search
MARTKQTARKSTGAKVPRKHIGSKQAHKQTPVSSSSGGVKKVHRFRPGTVALREIRKYQK
STDLLIRKLPFQRLVREIAQEFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR
VTIMPKDIHLARRIRGERS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtacaaaacaaaccgcacgtaaatcaactggtgctaaagtaccacgtaaacac
attggttctaaacaagcccataaacaaactccagtctcttcatcaagtggtggtgtaaag
aaagtacatcgtttcagaccaggtactgtcgctcttagagaaatcagaaaataccaaaag
agtaccgatctcttaattcgtaaactcccattccaacgtttagtcagagaaatcgcacaa
gaattcaaaaccgatcttcgtttccaatctgccgccatcggtgcccttcaagaagcctct
gaagcttacttggttggtttattcgaagataccaatttatgtgccatccacgctaaacgt
gttactatcatgccaaaagatattcacttagccagacgtatcagaggtgaaagatcataa

DBGET integrated database retrieval system