KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0267590
Entry
DDB_G0267590      CDS       T00245                                 

Definition
(RefSeq) GRAM domain-containing protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: GRAM V-SNARE_C SNARE Snapin_Pallidin gp32 GalP_UDP_transf
Other DBs
NCBI-GeneID: 8615952
NCBI-ProteinID: XP_647149
dictyBase: DDB_G0267590
UniProt: Q55GN5
Position
1
AA seq 461 aa
MTSPADKANHLKVKTELVRRTFNYPETENVIQDYSCALNKVTLGKMYITENFLSFIASIG
STTETIPLRKILEMKKDTTLFVNNAITFKTAEQLVSFGTFSHRDEAFTLIYHLWKCPPFI
YNPNSVDKDLDEKNLFRGAGQQKQKQLSSRVDTQSTKLALKLATETKETGIATLNELSYQ
AEVIDGIEAKMDNIHANLDRSDRLLKGIESVGGALSNHFSKDTTNGPRKEFAPLDRSLQV
RPRDEPPIEIDILEKLANDSLIPGFVQIHNDRFIILDANRKPRTEIISTYTFDSVEYLVI
RARPQHMDVRFFNNKYPRFRMASSYIQNVVNEIVLRSNGKYGKAPQVIFEPGIKEFIYGN
PTIRFIPSSGRSQQSSLFTRASTLGTSHFIKDASDDIKDALIEQDKDLDEISDLLGDISN
IAKTIGDEAERSSSQLDRITDKVDHANDRLKNNNKRIQKML
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgacatcaccagcagataaagcaaatcatttaaaagttaaaacagaacttgttagaaga
acatttaattatccagaaacagaaaatgttattcaagattactcatgtgctttaaataaa
gtaacattaggaaaaatgtatattacagaaaactttttatcatttatagcttcaattggt
agtacaactgaaacaataccattaagaaaaattttagagatgaaaaaagatacaacatta
tttgtaaataatgcaataacatttaaaacagcagaacagttagtatcatttggtacattt
tcacatagggatgaagcatttacattgatttatcatctttggaaatgtccaccatttata
tataatccaaattcagttgataaagatttagatgaaaagaatttatttcgaggtgctgga
caacagaaacaaaaacaactttcatctagagtggatacacaatcgacaaagttggcattg
aaattggccacagagacaaaggagacgggtatagcaactttgaacgagttgtcctatcag
gcagaggtgatcgatgggatagaggcaaagatggacaacattcatgccaatctcgacaga
tccgatcgattgttgaaaggaattgagagtgtggggggagccttgtccaaccatttcagt
aaagatacaaccaacggaccaagaaaggagtttgcccccttggatagatcgttgcaggtc
agaccaagggacgaacctcccattgagatcgacatattggagaaattggcaaacgatagt
ttgataccaggtttcgtgcaaattcacaacgacagattcatcatattggatgccaatagg
aagcccagaaccgagatcatctcgacctacactttcgacagtgtcgagtatttggtgatt
cgtgcacgtcctcagcatatggatgtcagattctttaataataaatacccacgttttaga
atggcaagcagttacattcaaaacgttgtcaatgagatcgttttacgttcaaatggaaag
tatggcaaagccccacaagttatctttgaacctggtatcaaagagtttatctatggcaac
ccaaccattcgtttcattccctcctctggtagatctcaacaaagctccctcttcactaga
gcttcaaccttaggtacaagtcatttcataaaagatgcctctgatgatattaaagatgct
ctaatcgaacaagataaagatttagatgaaatctctgatctattaggtgatattagtaat
atagcaaaaacaattggtgatgaagctgaacgtagttcttcacaacttgatagaataact
gataaagttgatcatgcaaatgatagattaaaaaataataataagaggattcaaaaaatg
ttataa

DBGET integrated database retrieval system