KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0267886
Entry
DDB_G0267886      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Motif
Pfam: Rad60-SLD ubiquitin SAP
Other DBs
NCBI-GeneID: 8616195
NCBI-ProteinID: XP_647386
dictyBase: DDB_G0267886
UniProt: Q55FZ7
Position
1
AA seq 563 aa
MDIDITKLENIQLNGIPLKNLKLVELQRELRSRGFTPRGNKLTHIVKLGTFLENEKDSTT
TKKTPTLSTTPTITIATPTIATPTLTIAIPTPTITTPTITIATPTISTPTISTPTTIPTP
TITKTARIKTLKKSGDDDLKSLQAKVKKTVTKTTAATRKKVVSKKSKVQTTVLTDKESIT
KLYETIIKDFNFSSNLKRFTTSFPTIDPHNIHEETTKYLILKLVNNEFRDLKSQQLLLLQ
QQQQEQKQEQQEQQEPQEIIKLIAPPMIRKFLEDMILDTFGYDIFNLMIQNFYKLENTNP
SFKIHNEQDKLFDDLISKKKRYEKTISKYKEYYGDIKNQDIWPPEFIEKMYGLTMEVTTS
LMEIPSIQIPEEPITIRFKLCCSKSTDFLEFNVKTNSRLGSVMKNVISEFGLSSKITTSS
SSSSYSSSSSSFSSSSEGNNYSFKFGNKTVYSTSTPFGLSLNNNDLIIIYLKNIYQDDKL
SNTITVTLIDSETLKKIHFSIARHSPLKKLINCFIEKKSTVHPNNINFTFKGKPISPQNT
CCDLSINDGDFIDAIIQNEIINL
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggatatagatattacaaaattagagaatatacaacttaatggtattcctttaaaaaac
cttaaattagtagaattacaaagggaacttaggtcaagaggattcacaccaagaggaaat
aaacttacacacattgtcaaactaggcacctttctagaaaatgagaaagattcaacaacc
accaaaaaaacacccacactatcaacaactccaacaataacaatagcgacaccaacaata
gcgacaccaacactaacaatagcaataccaacacctacaataacaacacctacaattaca
atagcaacacctacaatatcaactcctacaatatcaactccaacaacaataccaacacct
acaataacaaaaacagcaagaataaagacacttaaaaagagtggtgatgatgatctgaag
tcactacaagcaaaagttaagaaaacagttacaaagacaacagcggcaacaagaaagaaa
gtggtatcaaagaaatcaaaggtgcaaacaacagtattaacagataaagaatcaataacc
aaattatatgaaaccataattaaagattttaatttttcatcaaatttaaaaaggtttaca
acttcttttccaacaatcgatcctcataatattcatgaagaaacaacaaaatatttaata
ttaaaattagttaataatgaatttagagatttaaaatctcaacaattattattattacaa
caacaacaacaagaacaaaaacaagaacaacaagaacaacaagaaccacaggaaataatt
aaattaatagcaccaccaatgattagaaaatttttagaagatatgattttagatacattt
ggttatgatatatttaatttaatgattcaaaatttctataaacttgagaatacaaatcct
tcatttaaaattcataatgaacaagataaactatttgatgatttaatttcaaagaaaaag
agatatgaaaaaaccatatctaaatataaagaatattatggtgatattaaaaaccaagat
atttggccacccgaattcattgagaaaatgtatggactaacaatggaggtaacaacctca
ctaatggagataccatcaatacaaatacctgaagaaccaataacaattagatttaaactt
tgttgtagtaaatcaactgatttcttagaatttaatgttaaaactaattcaagattaggt
tcagtaatgaaaaatgtaattagtgaatttggtttatcttcaaaaattacaacatcatcg
tcatcatcttcatattcttcttcttcttcttctttttcctcttcttctgaaggaaataat
tactcattcaaatttggtaataaaactgtatatagtacatcaacaccatttggtttatca
ttaaataataatgatttaattattatctatttaaagaatatatatcaagatgataaatta
tcaaatacaataactgtaactctaatagatagtgaaactttaaagaaaattcatttctca
attgcaagacatagtcctttgaaaaagttaatcaattgttttattgaaaagaaatcaaca
gtacatccaaataatataaatttcacttttaaaggtaaaccaatttctcctcaaaatact
tgttgtgatttatcaattaatgatggtgattttattgatgcaataattcaaaatgaaata
attaatttataa

DBGET integrated database retrieval system