KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0268620
Entry
DDB_G0268620      CDS       T00245                                 

Gene name
pkbA
Definition
(RefSeq) AKT family protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi05208  Chemical carcinogenesis - reactive oxygen species
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ddi01001]
    DDB_G0268620 (pkbA)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DDB_G0268620 (pkbA)
Protein kinases [BR:ddi01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   DDB_G0268620 (pkbA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH PH_11 Pkinase_C PH_3 ABC1 Kinase-like PH_8 APH
Other DBs
NCBI-GeneID: 8616573
NCBI-ProteinID: XP_646888
dictyBase: DDB_G0268620
UniProt: P54644
Position
1
AA seq 444 aa
MSTAPIKHEGFLTKEGGGFKSWKKRWFILKGGDLSYYKTKGELVPLGVIHLNTSGHIKNS
DRKKRVNGFEVQTPSRTYFLCSETEEERAKWIEILINERELLLNGGKQPKKSEKVGVADF
ELLNLVGKGSFGKVIQVRKKDTGEVYAMKVLSKKHIVEHNEVEHTLSERNILQKINHPFL
VNLNYSFQTEDKLYFILDYVNGGELFYHLQKDKKFTEDRVRYYGAEIVLALEHLHLSGVI
YRDLKPENLLLTNEGHICMTDFGLCKEGLLTPTDKTGTFCGTPEYLAPEVLQGNGYGKQV
DWWSFGSLLYEMLTGLPPFYNQDVQEMYRKIMMEKLSFPHFISPDARSLLEQLLERDPEK
RLADPNLIKRHPFFRSIDWEQLFQKNIPPPFIPNVKGSADTSQIDPVFTDEAPSLTMAGE
CALNPQQQKDFEGFTYVAESEHLR
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtcaacagcaccaattaaacatgaaggtttcctcactaaagaaggtggtggtttcaaa
agttggaaaaagagatggttcattctcaaaggtggtgatttaagttattataaaacaaaa
ggtgaacttgtaccattaggagttattcatttaaatacatcaggtcatattaaaaattct
gatcgtaagaaaagagttaatggatttgaagtacaaacaccatcacgtacatatttctta
tgttcagagacagaggaagaacgtgcaaaatggatagagatattaattaatgaaagagaa
ttattattgaatggtggtaaacaaccaaagaaatcggaaaaggtaggagttgcagatttt
gaattattgaatttagttggtaaaggtagttttggtaaagttattcaagttagaaagaaa
gatactggtgaagtgtatgcaatgaaagttttatcaaagaaacatatcgtagagcataac
gaagtcgaacatacattgagtgagcgtaatattcttcaaaagatcaatcacccatttttg
gttaatctcaactacagttttcaaacagaggataagctttactttatcttggattatgtt
aatggtggtgagttattctatcatcttcaaaaggacaaaaagtttacagaggatcgtgtc
cgttattatggcgcagagatcgtattggcattggaacatttacatttgtcgggtgtcatc
tatagagatttgaaaccagagaatttactactcaccaacgagggtcacatttgcatgacc
gatttcggtctttgcaaagagggtctattgacaccaaccgacaaaactggtactttctgt
ggtactcctgaatatttagcacccgaagtacttcaaggcaatggttatggtaaacaagtg
gattggtggagttttggttctctcctctatgaaatgctcactggtttaccaccattctac
aatcaagacgtccaagagatgtatcgtaagatcatgatggagaaattatctttcccacat
ttcatttctccagatgctcgttccctcttggaacaactcttggaaagagatcctgaaaaa
agacttgccgatccaaatcttattaaaagacatcctttcttccgttccatcgattgggaa
caattattccaaaagaatattccaccaccattcattccaaatgttaaaggttctgctgat
acctctcaaattgatccagttttcactgatgaagctccttctttaactatggctggtgaa
tgtgctttaaatccgcaacaacaaaaagattttgaaggatttacatatgtcgctgaatct
gaacatttaagataa

DBGET integrated database retrieval system