KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0268632
Entry
DDB_G0268632      CDS       T00245                                 

Gene name
abpA
Definition
(RefSeq) actin binding protein A
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
SSDB
Motif
Pfam: CH Spectrin EF-hand_1 EF-hand_7 CAMSAP_CH EF-hand_6 EF-hand_8 EFhand_Ca_insen EF-hand_5 EF-hand_11 EF-hand_4
Other DBs
NCBI-GeneID: 8616670
NCBI-ProteinID: XP_646979
dictyBase: DDB_G0268632
UniProt: P05095
Position
1
AA seq 861 aa
MSEEPTPVSGNDKQLLNKAWEITQKKTFTAWCNSHLRKLGSSIEQIDTDFTDGIKLAQLL
EVISNDPVFKVNKTPKLRIHNIQNVGLCLKHIESHGVKLVGIGAEELVDKNLKMTLGMIW
TIILRFAIQDISIEELSAKEALLLWCQRKTEGYDRVKVGNFHTSFQDGLAFCALIHKHRP
DLINFDSLNKDDKAGNLQLAFDIAEKELDIPKMLDVSDMLDVVRPDERSVMTYVAQYYHH
FSASRKAETAGKQVGKVLDTFMLLEQTKSDYLKRANELVQWINDKQASLESRDFGDSIES
VQSFMNAHKEYKKTEKPPKGQEVSELEAIYNSLQTKLRLIKREPFVAPAGLTPNEIDSTW
SALEKAEQEHAEALRIELKRQKKIAVLLQKYNRILKKLENWATTKSVYLGSNETGDSITA
VQAKLKNLEAFDGECQSLEGQSNSDLLSILAQLTELNYNGVPELTERKDTFFAQQWTGVK
SSAETYKNTLLAELERLQKIEDSLVEFAKRAAQLNVWIEAADDHVFDPINVDSVQGVQEI
QEKFDAFLHDQSQQFAELEALAALTQQLRELGRSENDYSVISYDELSAKWNNLLAGIEER
KVQLANELTTQTNNDVLCQSFSVKANEISDYVRVTLDAISQNTSSDPQEQLNNIRAIITA
HAEKKPELDELYTIASQLEEAQVVDNKHTQHSLESIKLKWDKLNTLAKKNEQVVEGEILA
KQLTGVTAEELSEFKACFSHFDKDNDNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTD
GNGTISFEEFIDYMVSSRKGTDSVESTKAAFKVMAEDKDFITEAQIRAAISDSKQIDYLL
ASMPAVEGGFDYNSFAEKLYQ
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgtcagaagaaccaaccccagtttcaggtaatgacaaacaactcttgaacaaagcttgg
gaaattacccaaaaaaaaactttcacagcatggtgtaattcacatttacgtaaacttgga
tcatcaattgaacaaattgatacagattttactgatggtattaaattagctcaattatta
gaagttatttcaaatgatccagtatttaaagtaaacaaaacaccaaaattaagaattcat
aatatccaaaatgttggtctctgtttaaaacatattgaatcacatggtgttaaattggtt
ggtattggtgctgaagagttagttgataaaaacttaaagatgactttgggtatgatttgg
acaatcattcttcgttttgccattcaagatatttcaattgaagaattgagtgccaaagaa
gcccttttactttggtgtcaaagaaagaccgaaggttatgaccgtgttaaagttggtaat
ttccatacctcattccaagatggtcttgccttttgtgctctcatccataaacatagacca
gatttaatcaactttgactctttaaacaaagatgataaagctggtaacttacaattggct
tttgatattgccgaaaaagaattggatatcccaaagatgttggatgtttccgatatgctc
gatgtcgttcgtccagatgaaagatcagtcatgacctacgtcgctcaatactaccatcac
ttttctgcctctagaaaagctgaaaccgccggtaaacaagttggtaaagttttagatacc
tttatgttgttagaacaaaccaaatctgattatcttaaaagagccaatgaactcgttcaa
tggattaacgataaacaagcatcacttgaatcacgtgattttggtgattccatcgaatct
gttcaaagtttcatgaacgctcataaagaatataaaaaaaccgaaaaaccaccaaagggt
caagaagtctctgaattggaagctatctacaattcattacaaactaaattacgtttaatt
aaacgtgaaccatttgttgcaccagctggtctcactccaaatgaaatcgattccacttgg
tccgctttagagaaagctgaacaagaacatgctgaagccctccgtattgaactcaaacgt
caaaagaaaattgcagttctcttacaaaaatacaatcgtattctcaagaaactcgaaaac
tgggccaccaccaaatctgtctacctcggttccaatgaaaccggtgacagtatcactgct
gttcaagctaaattaaagaatttagaagcttttgatggtgaatgtcaatcattggaaggt
caatcaaactctgatctcctcagcattcttgctcaattaactgaactcaactacaatggt
gtaccagaactcactgaacgtaaagatacattctttgctcaacaatggactggtgttaaa
tcatctgctgaaacctacaaaaacactcttttagctgaacttgaaagactccaaaagatt
gaagactcattggtcgaattcgccaagagagccgctcaattaaatgtttggattgaagct
gccgatgatcatgtatttgatccaatcaatgttgactctgttcaaggtgtccaagaaatt
caagagaaattcgacgctttcctccacgatcaatcacaacaattcgctgaattggaagcc
ctcgctgctttaactcaacaactccgtgaactcggtcgttctgaaaacgattattcagtc
atttcatacgatgaactctctgccaaatggaataatttattggctggtattgaagaacgt
aaagttcaactcgccaatgaactcaccactcaaaccaacaacgatgttctttgccaatca
ttctctgttaaagcaaatgaaatttcagattatgtccgtgttactttagatgccatctca
caaaacacttcatcagatccacaagaacaattaaacaatatccgtgctatcatcaccgct
catgctgaaaagaaaccagaactcgatgaattatacaccattgcttctcaactcgaagaa
gctcaagttgtcgataacaaacatactcaacacagtttagaatcaattaaattaaaatgg
gataaactcaatacactcgctaaaaagaatgaacaagttgttgaaggtgaaattcttgct
aaacaattaactggtgttactgctgaagaattaagtgaatttaaagcctgcttctcacat
ttcgataaggacaacgataacaaattaaatcgtcttgaattctcctcttgcttgaagagt
atcggagatgaattaactgaagaacaattaaatcaagtcatcagtaaaatcgataccgat
ggtaatggtaccatttcattcgaagaatttattgattacatggtttcatcacgtaaaggt
acagacagcgttgaatcaactaaagctgcattcaaagttatggctgaggataaagatttc
attactgaagctcaaattcgtgctgctatctctgattctaaacaaattgattatttactc
gccagtatgccagctgttgaaggtggttttgactacaattcatttgctgaaaaattatac
caataa

DBGET integrated database retrieval system