KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269144
Entry
DDB_G0269144      CDS       T00245                                 

Gene name
hspB
Definition
(RefSeq) heat shock cognate protein Hsc70-1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03040  Spliceosome
ddi04141  Protein processing in endoplasmic reticulum
ddi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    DDB_G0269144 (hspB)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    DDB_G0269144 (hspB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    DDB_G0269144 (hspB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ddi01009]
    DDB_G0269144 (hspB)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ddi03041]
    DDB_G0269144 (hspB)
   03009 Ribosome biogenesis [BR:ddi03009]
    DDB_G0269144 (hspB)
   03110 Chaperones and folding catalysts [BR:ddi03110]
    DDB_G0269144 (hspB)
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0269144 (hspB)
   03051 Proteasome [BR:ddi03051]
    DDB_G0269144 (hspB)
   03029 Mitochondrial biogenesis [BR:ddi03029]
    DDB_G0269144 (hspB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0269144 (hspB)
Protein phosphatases and associated proteins [BR:ddi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     DDB_G0269144 (hspB)
Spliceosome [BR:ddi03041]
 Complex B
  Other components
   Prp19 complex
    DDB_G0269144 (hspB)
 Complex C
   Prp19-CDC5 complex
    DDB_G0269144 (hspB)
Ribosome biogenesis [BR:ddi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    DDB_G0269144 (hspB)
Chaperones and folding catalysts [BR:ddi03110]
 Heat shock proteins
  HSP70 / DNAK
   DDB_G0269144 (hspB)
Membrane trafficking [BR:ddi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    DDB_G0269144 (hspB)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    DDB_G0269144 (hspB)
Proteasome [BR:ddi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    DDB_G0269144 (hspB)
Mitochondrial biogenesis [BR:ddi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    DDB_G0269144 (hspB)
Exosome [BR:ddi04147]
 Exosomal proteins
  Proteins found in most exosomes
   DDB_G0269144 (hspB)
SSDB
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A FGGY_C DDR DUF2115
Other DBs
NCBI-GeneID: 8617589
NCBI-ProteinID: XP_646617
dictyBase: DDB_G0269144
UniProt: P36415
Position
1
AA seq 640 aa
MSSIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP
TNTVFDAKRLIGRKFSDKEVQSDMKHWPFKVIPKDGDKPHIQVEFKGETKVFSPEEISSM
VLLKMKETAEAYLGKTINNAVITVPAYFNDSQRQATKDAGTISKLNVQRIINEPTAAAIA
YGLEKKGSGEKNILIFDLGGGTFDVSLLTIEDGVFEVKATAGDTHLGGEDFDNRLVSHFV
DEFKRKHKKDIMGNQRAVRRLRTACERAKRTLSSSAQASIEIDSLFEGIDFYTSITRARF
EELCADLFRGCLDPVEKVLKDSKLDKKSIHEIVLVGGSTRIPKVQQLLQEFFNGKELNKS
INPDEAVAYGAAVQAAILSNEGGAKVADLLLLDVAPLSMGLETAGGVMTTLIPRNTTIPC
KKTQTFSTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQVEVTFDVDA
NGILNVSAEDKSTGNKQKITITNDKGRLSKEEIEKMVADAEKFKQQDEQQKDRVESKNKL
ENYAFTVKNSIKDEKVAAKISDSDKSTIESETESVLKWLESNQTAEKDEYEDKMKALEAV
VNPIMSKLYQEGGMPQGGGMPGGMSNDSPKSSNNKVDELD
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgtcatcaattggtattgatttaggtacaacatattcatgtgttggtgtttggcaaaat
gatcgtgttgaaattattgcaaatgatcaaggtaatagaaccactccatcttatgttgca
tttactgatacagaacgtttaattggtgatgctgcaaagaatcaagttgcaatgaatcca
accaatacagtatttgatgctaaacgtttaattggtcgtaaatttagtgacaaagaagtt
caaagtgatatgaaacattggccattcaaagttattccaaaggatggtgataagccacat
attcaagttgaattcaaaggtgaaactaaagttttctcaccagaagaaatctcttcaatg
gtactcttaaaaatgaaagaaaccgctgaagcttatcttggtaaaaccattaataatgct
gtaattaccgttccagcttatttcaatgatagtcaacgtcaagcaaccaaagatgctggt
acaatttcaaaattaaatgttcaacgtattattaatgaaccaactgctgctgctattgct
tatggtttagaaaagaaaggttctggtgaaaagaatattttaattttcgatttaggtggt
ggtacatttgatgtttctctccttaccattgaagatggtgtatttgaagttaaagccacc
gctggtgatactcatttaggtggtgaagattttgataatcgtctcgtttctcactttgtt
gatgaatttaaacgtaaacataaaaaagatattatgggtaatcaacgtgctgttcgtcgt
ttaagaactgcttgtgaacgtgccaaaagaactctttcatcatctgctcaagcttcaatt
gaaattgattcactctttgaaggtattgatttctatacttcaattactagagcacgtttt
gaagaactctgtgctgatcttttccgtggttgtttagatccagttgaaaaagtattaaaa
gatagtaaattggataagaaatcaattcatgaaattgttttagttggtggttcaactcgt
attccaaaggtacaacaattattacaagaatttttcaatggtaaagaattgaataaatca
attaatccagatgaagctgttgcttatggtgccgctgtacaagctgcaattctttcaaat
gaaggtggtgctaaagttgctgatcttttattgttagatgttgcaccattatcaatgggt
ttagaaactgctggtggtgttatgacaactcttattccaagaaatacaacaattccatgt
aagaaaactcaaaccttctctacatactctgataatcaaccaggtgtattaattcaagtt
tatgaaggtgaacgtgctatgaccaaagataataatttattgggtaaatttgaactttct
ggtattccaccagcaccaagaggtgtaccacaagttgaagttacatttgatgttgatgca
aatggtatcttaaatgtatcagctgaagataaatcaactggtaacaaacaaaagattaca
attaccaatgataaaggtcgtctttcaaaagaagaaattgaaaaaatggttgctgatgca
gagaaattcaaacaacaagatgaacaacaaaaagatcgtgttgaatcaaagaataaattg
gaaaattatgcattcactgttaaaaattcaattaaagatgaaaaagttgcagccaaaatt
tcagattcagataaatcaactattgaatctgaaactgaaagtgtactcaaatggttagaa
tcaaatcaaaccgcagaaaaggatgaatatgaagataagatgaaagccttagaagcagtt
gtcaatccaatcatgagtaaactctatcaagaaggaggtatgccacaaggtggtggtatg
ccaggtggtatgtcaaatgattcaccaaagagttcaaacaacaaagtagacgaattagat
tga

DBGET integrated database retrieval system