KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269216Help
Entry
DDB_G0269216      CDS       T00245                                 

Gene name
cypE
Definition
(RefSeq) cyclophilin-type peptidylprolyl cis-trans isomerase
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    DDB_G0269216 (cypE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ddi03041]
    DDB_G0269216 (cypE)
   03110 Chaperones and folding catalysts [BR:ddi03110]
    DDB_G0269216 (cypE)
Enzymes [BR:ddi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     DDB_G0269216 (cypE)
Spliceosome [BR:ddi03041]
 Complex B
  Other components
   Prp19-related factors
    DDB_G0269216 (cypE)
 Complex C
    DDB_G0269216 (cypE)
Chaperones and folding catalysts [BR:ddi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    DDB_G0269216 (cypE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase Glyco_hydro_36
Motif
Other DBs
NCBI-GeneID: 8617195
NCBI-ProteinID: XP_646239
dictyBase: DDB_G0269216
UniProt: Q9NI62
Position
1
AA seq 156 aa AA seqDB search
MTEQTVTLQTTVGDITLELYYNHAPKACKNFYELSKRGYYDNTIFHRLIKDFMIQGGDPL
GNGRGGESIYGKKFEDEITKELKHTGAGILSMANSGVNSNGSQFFITFGPTPWLDGKHTI
FGRVKSGMKVVQKMNAMQTNNDKPIDEIRIIKATAN
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaaacagtaacacttcaaacaacagttggtgatattacattggaattatat
tataaccatgcaccaaaagcatgtaaaaacttttatgaattgtcaaaaagaggatattat
gataatacaatttttcacagacttattaaagattttatgatacaaggaggagatccatta
ggaaatggtcgtggaggtgaaagtatatatggaaaaaaatttgaagatgaaattacaaaa
gaattaaaacatacaggtgcaggaatattatcaatggcaaacagtggtgttaattctaat
ggatcacaatttttcattacatttgggcctacaccttggttagatggaaagcatacaatc
tttggaagagttaaatctggaatgaaagttgtacaaaaaatgaatgcaatgcaaacaaat
aacgataaaccaattgatgaaattagaataattaaagcaactgcaaattaa

DBGET integrated database retrieval system