KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269848
Entry
DDB_G0269848      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K13513  lysocardiolipin and lysophospholipid acyltransferase [EC:2.3.1.- 2.3.1.51]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00561  Glycerolipid metabolism
ddi00564  Glycerophospholipid metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
Module
ddi_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    DDB_G0269848
   00564 Glycerophospholipid metabolism
    DDB_G0269848
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddi01004]
    DDB_G0269848
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     DDB_G0269848
    2.3.1.-  
     DDB_G0269848
Lipid biosynthesis proteins [BR:ddi01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   DDB_G0269848
SSDB
Motif
Pfam: Acyltransferase Acyltransf_C
Other DBs
NCBI-GeneID: 8617294
NCBI-ProteinID: XP_646339
dictyBase: DDB_G0269848
UniProt: Q55CZ2
Position
1
AA seq 364 aa
MEEVLKYFRRISSIIILLVSSVYAATFLMFPVIALIEPFYKKLAFKLQAKIASGWFRLVL
FVFEVLNGIEIRYYGEDDIQEGESLIMMMNHPSEIDWLFSFSIAQRKKALSNIKVLLKNE
VRFVPGVGWGCDNLDYIFLTRDWTFDENHIEYKINKYKESECKPWLVIFPEGTDIDDVKL
KKSWDFAEKNGFPKFNNVLLPRHKGLHACVEPLRDTIDCVYDLTIGYEGKPTILSCISGT
SPRVVNIHIKRYSLDEIPKDENQLQKWLFNRYHEKDQMLQYLKENKTYSMPYRIHKPSLS
IYASAFLWFYYFMLPITNLLLISSFTRVYFIIAFVYHILNSKYEPLRKLRGLQNAIYSKK
EKSH
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggaagaagtattaaaatattttagacgtatttcatcaattattatacttttagtttca
tcagtgtatgcagcaacatttttaatgtttcctgtgattgcattgattgaaccattttat
aaaaagttagcattcaaattacaagctaaaatcgcatcgggatggtttagattggtttta
tttgttttcgaagttctcaatggtatagaaattagatattatggtgaagatgatattcaa
gaaggggaatcactcattatgatgatgaatcatccatcagaaattgattggttattctct
tttagtattgcacaaagaaagaaagctttatcaaatattaaggttttattgaaaaatgaa
gtaagatttgtaccaggtgttggttggggatgtgataatttagattacatctttttaaca
agagattggacattcgatgaaaatcatattgaatataaaattaataaatataaagaaagt
gaatgtaaaccatggttagttattttcccagagggtaccgatattgatgatgttaaatta
aaaaaaagttgggattttgcagaaaagaatggattcccaaaatttaataatgtactttta
ccaagacataaaggtttacatgcatgtgttgaaccattaagagatacaattgattgtgta
tatgatttaacaatcggttatgaaggtaaaccaaccattttatcatgtattagtggaaca
agtccaagagttgtaaatattcatattaagagatattcacttgatgaaattccaaaggat
gaaaaccaacttcaaaaatggttatttaatcgttatcatgaaaaagatcaaatgttacaa
tacttaaaagaaaataaaacttattcaatgccatatagaattcataaaccttcattatca
atttatgcatcagcatttttatggttttattactttatgttaccaatcaccaatttactt
ttaatttcttcatttacaagagtgtactttatcatagcatttgtttatcacattttaaat
tcaaaatatgaaccacttcgtaaattaagaggattacaaaatgcaatttattcaaaaaaa
gaaaaatctcattaa

DBGET integrated database retrieval system