KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269912
Entry
DDB_G0269912      CDS       T00245                                 

Gene name
redB
Definition
(RefSeq) NADPH-cytochrome-P450 oxidoreductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DDB_G0269912 (redB)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     DDB_G0269912 (redB)
SSDB
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 TMEM171 THF_DHG_CYH DUF2786
Other DBs
NCBI-GeneID: 8617355
NCBI-ProteinID: XP_646400
dictyBase: DDB_G0269912
UniProt: Q55CT1
Position
1
AA seq 667 aa
MEILESIDFIEVLILDNLGAIIIVAVIVGTYLYMNKPPPPPPVFNKPNNKINKEAQKPKK
TITKNEDGKKVMKIFFGTQTRTAEDFSRIIEKECKKIGIPCEVVDLESYEHEQELHSESF
VMFLVATHGEGDPTDNAKEFYLWLTNDERPTDLLNGVPFTVFGLGNKTYEHYNAVARVID
RRMEELGGKRVFERGEGDDDATLEEDFNRWKKDMWPVVCKFLGYELKSTEDDKFVPRFRM
VTLNQDSKDINDPFIKIVSTPLKPKLSTDNKVIYDMKNPYYAEVLENRELHSNESDRSCR
HIEFKLGDEVSYTTGDHLGVFPINDSKLVEQLIKRLGVNGDDMIALVPIDQEGSVIKASF
GPMTIRRAFSEHLDITNPVRKSVLRALAESTTNEEEKKRLLYLATEEANEEYNKYIKNDF
RGVVDLLESFPGLQPLIAHFLEFTPRLPARMYSISSSPHNKNGVVSITSVVVNFTTGNQR
AHNGVASTWLSHLKVGDKVPLFVRESHFKLPSAATEQKPVIMVGPGTGLAPFRGFLQELQ
HRNHSQQQQSLLFFGCRSDTVDYIYREELEQYHQSSVLGDLVVAFSRKTSQKVYVQNKLL
EHKEKVWELLNKGAYFYVCGDGRNMSKAVQQALLSIIKEFGSKDDNSAQQFIDDMSSHGR
YLQDVWF
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggaaattttagaatcaattgattttattgaagttttaattttagataatttaggagcg
attattattgttgcagttatagtgggtacatacctttatatgaacaaaccaccaccacca
ccaccagtatttaataaaccaaacaataagatcaacaaagaagcacaaaaaccaaaaaag
acaatcacaaagaatgaagacggtaaaaaggtgatgaaaatattctttggtacacaaaca
cgtacagccgaagatttctcaagaatcattgaaaaagaatgtaaaaagattggtatccca
tgtgaagttgtagacttggaatcctatgaacacgaacaagaattacatagtgaaagtttt
gtaatgtttttagttgcaactcatggcgaaggtgatccaaccgataatgccaaagaattc
tacctttggttaacaaatgatgaacgtccaaccgatcttctcaatggtgtaccattcact
gtatttggtttaggtaataaaacttatgaacattacaatgccgttgcacgtgttatcgat
agaagaatggaagaattaggtggtaaaagagtctttgaaagaggtgaaggtgatgatgat
gcaactcttgaagaagatttcaatcgttggaaaaaagatatgtggcctgtagtttgtaaa
ttcttaggttatgaattaaaatcaactgaagatgataaattcgtaccaagatttagaatg
gtaactttaaatcaagatagtaaagatattaatgatcctttcattaaaatcgtttcaact
ccattaaaaccaaaattatcaactgataataaagtaatttatgatatgaaaaatccatat
tatgcagaggttttagaaaatagagaattacattcaaatgaatctgatagatcatgtaga
catattgaatttaaattgggtgatgaagttagttatacaacaggtgatcatttaggtgta
ttcccaattaatgatagtaaattggttgaacaattgataaagcgtttgggtgtcaatggt
gatgatatgattgcattggtaccaattgatcaagagggttcagttattaaagcaagcttt
ggtccaatgacaattagaagggcattctctgaacatttggatattacaaatccagtacgt
aaatcagtgttacgtgcattggcagagtcaaccactaacgaagaggaaaagaagagatta
ttatatttagcaaccgaagaagcaaacgaagaatacaataaatatattaaaaatgatttc
cgtggtgtcgtcgatcttttagaatctttcccaggtcttcaacctttgattgctcacttt
ttagaatttacaccacgtctaccagcccgtatgtactctatctcctcttcacctcacaat
aagaatggcgttgtttcaattacctctgtagtggttaatttcacaactggtaatcaaaga
gctcataatggtgtcgcctctacttggttatctcacttaaaagttggcgataaagttcca
ttatttgttagagaatctcactttaaattaccatctgccgccaccgaacaaaaacctgtc
attatggttggtcctggtactggtttagctcctttcagaggtttccttcaagaattacaa
catagaaatcattcacaacaacaacaatcactcttattctttggttgtcgttccgataca
gtcgactatatttacagagaagagttggaacaatatcatcaatcctcagttttaggtgat
ttggttgtagctttctcaagaaaaacttctcaaaaagtttatgtacaaaataaattattg
gagcataaagaaaaggtttgggagttattaaataaaggtgcctacttttacgtttgtggt
gatggtagaaatatgtccaaagctgtacaacaagccctcttatcaatcattaaagaattt
ggttcaaaagatgataactctgctcaacaattcattgacgatatgagttctcatggtaga
tatttacaagatgtttggttttaa

DBGET integrated database retrieval system