KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0269942
Entry
DDB_G0269942      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K08517  vesicle transport protein SEC22
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi04130  SNARE interactions in vesicular transport
ddi04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    DDB_G0269942
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    DDB_G0269942
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0269942
Membrane trafficking [BR:ddi04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    DDB_G0269942
SSDB
Motif
Pfam: Longin Synaptobrevin DUF1016_N DUF5715
Other DBs
NCBI-GeneID: 8617378
NCBI-ProteinID: XP_646421
dictyBase: DDB_G0269942
UniProt: Q55CR0
Position
1
AA seq 214 aa
MVLFAMLCRVTDGLMLSESMDTLNPTFDKYRLQAKAIISKLSRVSDKAVTVDANDKYYFA
YIIEHEICYLAFCEKSYSKKLVFRFLDDLQKEFYNTYGFEVPSAKRPYQFIAFESFITKT
KKLYQDTRAQKNLSNISVELDEVRNIMTKNIKDIVGRGEKLNELNDKTEFLLADSLKYEK
QTVALSSKLFFKKYGPILIIAFFALFLYIYLYYF
NT seq 645 nt   +upstreamnt  +downstreamnt
atggtattatttgcaatgctttgtagggtaactgatgggttaatgctttcagaatcaatg
gatacattaaatccaacatttgataaatatagattacaagcaaaagcaattatttcaaaa
ttatcaagagtttctgataaagcagtaactgttgacgccaatgataaatattattttgct
tatattattgaacatgaaatatgttatttagcattttgtgaaaagtcatattcgaaaaaa
ttagtttttagatttttagatgatttacaaaaagaattttacaatacatacggttttgaa
gtaccttctgcaaagagaccttatcaatttattgcatttgaatcctttattacaaaaaca
aaaaagttatatcaagatacaagagctcaaaagaatctttcaaatatttcagtagaatta
gatgaagtaagaaatataatgacgaaaaatattaaagatatagttggaagaggtgaaaaa
ttaaatgaattaaatgataaaacagaatttcttttagcagattcattaaaatatgaaaaa
caaacagtagcattaagttcaaaattattctttaaaaaatatggtccaattctcattata
gcgttttttgctttattcctttatatatatctttattatttttaa

DBGET integrated database retrieval system