KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0270270
Entry
DDB_G0270270      CDS       T00245                                 

Gene name
gpsn2
Definition
(RefSeq) synaptic glycoprotein SC2-like protein
  KO
K10258  very-long-chain enoyl-CoA reductase [EC:1.3.1.93]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00062  Fatty acid elongation
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01212  Fatty acid metabolism
Module
ddi_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    DDB_G0270270 (gpsn2)
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0270270 (gpsn2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddi01004]
    DDB_G0270270 (gpsn2)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.93  very-long-chain enoyl-CoA reductase
     DDB_G0270270 (gpsn2)
Lipid biosynthesis proteins [BR:ddi01004]
 Fatty acid synthase
  Component type
   DDB_G0270270 (gpsn2)
SSDB
Motif
Pfam: Steroid_dh DUF1295 ubiquitin PEMT
Other DBs
NCBI-GeneID: 8617636
NCBI-ProteinID: XP_646664
dictyBase: DDB_G0270270
UniProt: Q55C17
Position
1
AA seq 300 aa
MVDIKVVSQRSKKEVGSFSTSSSTTVGELKKQISSKTRLGTERIRLAVPSKTSKLPNAFE
ALGKDSDLVSKHVGADSTLYFKDLGPQISWSLVFICEYAGPLFVYPIFYFLSNLIYGTDS
PKSFAQKVALVCYSLHYIKRIYETIFVHRFSHGTMPIFNLFKNCSYYWGCTAMVSYFVNH
PLYTEAPIERVYLGLGLWIIGEVFNYICHIQLRNLRPAGSTERKIPRGLLFEFVSCPNYT
VEILSWIGFSILTQTLTSWIFALMGAAQMWIWAVGKHRRYRKEFGDKYPKSRKILIPFLL
NT seq 903 nt   +upstreamnt  +downstreamnt
atggttgatattaaagttgtttcacaaagatcaaaaaaagaagttggttcattttcaact
tcttcgtcaacaacagttggtgaattaaaaaagcaaatttcctcaaagactagacttgga
acagaaagaattagattagcagtaccaagtaagacctcaaaattaccaaatgcatttgag
gcattaggtaaagatagtgatttagtctctaaacatgtcggagcagattcaaccctttac
tttaaagatttaggtccacaaatttcatggtcattagttttcatttgtgaatatgcaggt
ccattatttgtttatccaatcttttactttttatcaaatttaatttatggtactgattca
ccaaaatcatttgctcaaaaagttgcattggtttgttattcacttcattatattaaaaga
atttatgaaacaattttcgttcatagatttagtcatggtacaatgccaatttttaatctt
tttaaaaattgttcatattattggggatgtacagcaatggtatcatactttgtaaatcat
ccactctacactgaagcaccaattgaacgtgtttaccttggtttaggattatggattatt
ggtgaagttttcaattacatttgtcatattcaattaagaaatcttcgtccagcaggttca
acagaacgtaagattccacgtggtttattatttgaatttgtatcatgtccaaattatacc
gttgaaatcttatcttggattgggttctcaattctcacacaaactttaacttcatggatt
ttcgcattaatgggtgctgctcaaatgtggatttgggctgttggtaaacatagaagatat
agaaaagaatttggtgataaatatccaaaatcaagaaaaattttaattccatttttactt
tga

DBGET integrated database retrieval system