KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0270312
Entry
DDB_G0270312      CDS       T00245                                 

Definition
(RefSeq) GNS1/SUR4 family protein
  KO
K10249  elongation of very long chain fatty acids protein 4 [EC:2.3.1.199]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00062  Fatty acid elongation
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01212  Fatty acid metabolism
Module
ddi_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    DDB_G0270312
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0270312
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddi01004]
    DDB_G0270312
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     DDB_G0270312
Lipid biosynthesis proteins [BR:ddi01004]
 Elongase
  PUFA
   DDB_G0270312
SSDB
Motif
Pfam: ELO DUF2633
Other DBs
NCBI-GeneID: 8617670
NCBI-ProteinID: XP_002649204
dictyBase: DDB_G0270312
UniProt: C7FZW5
Position
1
AA seq 263 aa
MFLVDYYNYLSERYDYYLTLRDERVLNWPLINRPHEMIYLVIGYFAIIFFGQKIMKKQKP
FELRYPLIIHNVVCTLLSLYMTIEITYQAYSNNYSLMCNSVDYSEKGLGMAKVLWLFYFS
KFIEFMDTFFMVLRKKDSQITVLHVYHHSTMPMLWIMGIWYAAGGDSYISALINSFIHTV
MYSYYALSLFGFNIWWKKYLTQLQLIQFAMNLIFSMWSLYNDCKFIKWMHWGMIIYMISF
LFLFGAFYKRSYSQPKKSTKKIQ
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtttttagttgactattataactatctttctgaaagatatgattattatttaacatta
agagatgaaagagtattaaattggccattaattaatagaccacatgaaatgatatattta
gttattggatattttgcaatcatattttttggtcaaaagataatgaagaaacaaaaacca
ttcgaattgaggtatccattaattattcataatgtggtttgtacattattaagtttatat
atgactattgaaattacatatcaagcatattcaaataactactctttaatgtgtaattct
gttgattatagtgaaaaaggtcttggtatggcaaaagtattatggttattctatttctca
aagtttattgaatttatggatacattttttatggttttaagaaaaaaagatagtcaaatt
actgttttacatgtatatcatcattctacaatgccaatgttatggattatgggaatctgg
tatgcggccggaggtgatagctatatttcagcattaatcaattcattcattcatacagtt
atgtacagttattatgcattatcattatttggatttaatatttggtggaagaaatattta
actcaattgcaattaattcaatttgctatgaacctaattttttcaatgtggtctttatat
aatgattgcaaattcattaaatggatgcattggggtatgattatatatatgattagtttc
ttattcttatttggtgcattctataaaagaagttattcccaaccaaagaaatcaacaaag
aaaattcaataa

DBGET integrated database retrieval system